Композиции и способы для усовершенствованной доставки пептидов, связывающихся с y2-рецепторами, которую осуществляют через слизистые оболочки, и способы лечения и предотвращения ожирения

Номер патента: 8829

Опубликовано: 31.08.2007

Авторы: Брэндт Гордон, Макевилли Конор Дж., Квей Стивен К., Клипп Мэри С.

Есть еще 22 страницы.

Смотреть все страницы или скачать PDF файл.

Формула / Реферат

1. Применение пептида PYY(3-36) для изготовления медикамента для лечения ожирения или контроля потребления пищи у пациента, причем введение через слизистые оболочки по меньшей мере 50 мкг указанного пептида в указанном медикаменте повышает концентрацию указанного пептида в плазме субъекта по меньшей мере на 5 пмоль/л.

2. Применение по п.1, причем введение медикамента вызывает чувство сытости.

3. Применение по п.1, причем введение медикамента вызывает потерю чувства голода.

4. Применение по п.1, причем введение медикамента вызывает потерю аппетита.

5. Применение по п.1, причем введение медикамента осуществляется перорально.

6. Применение по п.1, причем введение медикамента осуществляется защечно.

7. Применение по п.1, причем введение медикамента осуществляется интраназально.

8. Применение по п.1, причем введение медикамента снижает потребление пищи.

9. Применение по п.1, причем введение медикамента способствует потере веса.

10. Применение по п.1, причем введение медикамента лечит ожирение.

11. Применение по п.1, причем введение медикамента предотвращает начало или развитие ожирения.

12. Применение по п.1, причем введение медикамента лечит диабет.

13. Применение по п.7, причем интраназально вводят приблизительно от 50 до 200 мкл медикамента.

14. Применение по п.13, причем вводят приблизительно 3-10 мгк пептида на килограмм массы тела.

15. Применение по п.13, причем вводят приблизительно от 50 до 800 мкг пептида.

16. Применение пептида PYY(3-36) для изготовления медикамента для лечения ожирения, причем время до достижения максимальной концентрации в плазме Тmax для указанного пептида после введения указанного медикамента млекопитающему через слизистые оболочки составляет менее 30 мин.

17. Применение по п.16, причем Тmax составляет около 20 мин.

18. Применение по п.16, причем при введении через слизистые оболочки время полувыведения указанного пептида составляет приблизительно 55 мин.

19. Применение пептида PYY(3-36) для изготовления медикамента для лечения ожирения у млекопитающих, причем однократное введение через слизистые оболочки указанного медикамента приводит к величине Сmax более 300 пг/мл.

20. Применение по п.19, причем величина Сmax больше 75 пмоль/л.

21. Применение пептида PYY(3-36) для изготовления медикамента для лечения ожирения у млекопитающих, причем воздействие указанного медикамента на слой эпителиальных клеток слизистой оболочки снижает электрическое сопротивление через этот слой по меньшей мере в 100 раз.

22. Применение по п.21, причем указанный слой эпителиальных клеток слизистой оболочки представляет собой монослой бронхиальных клеток.

23. Применение пептида PYY(3-36) для изготовления медикамента для лечения ожирения у млекопитающих, причем воздействие указанного медикамента на слой эпителиальных клеток слизистой оболочки увеличивает прохождение пептида через этот слой по меньшей мере в 30 раз по сравнению с простыми буферными растворами.

24. Применение по п.23, причем указанный слой эпителиальных клеток слизистой оболочки представляет собой монослой бронхиальных клеток.

25. Применение пептида PYY(3-36) для изготовления медикамента для лечения ожирения у млекопитающих, причем введение через слизистые оболочки указанного медикамента повышает концентрации указанного пептида в плазме, не вызывая неблагоприятных побочных эффектов, таких как тошнота или головокружение.

26. Применение пептида PYY(3-36) для изготовления медикамента для лечения ожирения у млекопитающих, причем медикамент состоит из солюбилизирующего агента, хелатирующего агента, одного или более полиолов и указанного пептида PYY.

27. Применение по п.26, причем медикамент дополнительно содержит поверхностно-активный агент.

28. Применение по п.26, причем солюбилизирующий агент представляет собой метил-b-циклодекстрин.

29. Применение по п.27, причем поверхностно-активный агент представляет собой L-a-фосфатидилхолин дидеканоил (DDPC).

30. Применение пептида PYY для изготовления медикамента для лечения ожирения у пациента, причем медикамент состоит из солюбилизирующего агента, хелатирующего агента, полиола и пептида PYY, причем пептид PYY имеет аминокислотную последовательность, выбираемую из группы, включающей последовательности SEQ ID NO: 2, 3 и SEQ ID NO: 90-105.

31. Применение по п.30, причем медикамент содержит по крайней мере два полиола.

32. Применение по п.31, причем полиолы выбирают из группы, включающей сахарозу, маннит, сорбит, лактозу, L-арабинозу, D-эритрозу, D-рибозу, D-ксилозу, D-маннозу, трегалозу, D-галактозу, лактулозу, целлобиозу, гентибиозу, глицерин и полиэтиленгликоль.

33. Применение по п.32, причем полиолы представляют собой лактозу и сорбит.

34. Применение по п.30, причем хелатирующий агент представляет собой этилендиамин тетрауксусную кислоту (ЭДТА) или этиленгликоль тетрауксусную кислоту (ЭГТА).

35. Применение по п.34, причем хелатирующий агент представляет собой ЭДТА.

36. Применение по п.30, причем солюбилизирующий агент выбирают из группы, включающей циклодекстран, гидроксипропил-b-циклодекстран, сульфобутиловый эфир b-циклодекстрана и метил-b-циклодекстрин.

37. Применение по п.36, причем солюбилизирующим агентом является циклодекстрин.

38. Применение по п.30, причем композиция дополнительно содержит поверхностно-активный агент.

39. Применение по п.38, причем поверхностно-активный агент выбирают из группы, включающей неионный полиоксиэтиленовый эфир, соли желчных кислот, такие как гликохолат натрия (SGC), деоксихолат (DOC), производные фусидовой кислоты, тауродигидрофусидат натрия(STDHF), L-a-фосфатидилхолин дидеканоил (DDPC), полисорбат 80 и полисорбат 20, полиэтиленгликоль (ПЭГ), цетиловый спирт, поливинилпирролидон (PVP), поливиниловый спирт (PVA), ланолиновый спирт и сорбитан моноолеат.

40. Применение по п.39, причем поверхностно-активный агент представляет собой DDPC.

41. Применение по п.30, причем композиция является водной композицией PYY, дополнительно включающей воду.

42. Применение по п.41, причем рН водной композиции PYY составляет приблизительно от 3 до 6.

43. Применение по п.42, причем рН водной композиции PYY составляет 5,0+0,3.

44. Применение по п.30, причем пептид PYY имеет последовательность PYY (3-36) (SEQ ID NO: 2).

45. Применение пептида PYY для изготовления медикамента для лечения ожирения у пациента, причем медикамент содержит пептид PYY и одно или более веществ из группы, включающей полиол, солюбилизирующий агент и хелатирующий агент, причем пептид PYY имеет аминокислотную последовательность, выбираемую из группы, включающей последовательности SEQ ID NO: 2, 3 и SEQ ID NO: 90-105.

46. Применение по п.45, причем введение медикамента вызывает чувство сытости.

47. Применение по п.45, причем введение медикамента вызывает потерю чувства голода.

48. Применение по п.45, причем введение медикамента вызывает потерю аппетита.

49. Применение по п.45, причем введение медикамента осуществляется перорально.

50. Применение по п.45, причем введение медикамента осуществляется защечно.

51. Применение по п.45, причем введение медикамента осуществляется интраназально.

52. Применение по п.45, причем введение медикамента снижает потребление пищи.

53. Применение по п.45, причем введение медикамента способствует потере веса.

54. Применение по п.45, причем введение медикамента лечит ожирение.

55. Применение по п.45, причем введение медикамента предотвращает начало или развитие ожирения.

56. Применение по п.45, причем введение медикамента лечит диабет.

57. Препарат пептида, связывающегося с Y2-рецепторами, для доставки через слизистые оболочки, способный повышать концентрацию пептида, связывающегося ё Y2-рецепторами, в плазме млекопитающего по меньшей мере на 5 пмоль в 1 л плазмы или более при введении указанному млекопитающему через слизистые оболочки дозы, содержащей по меньшей мере 50 мкг агониста, связывающегося с Y2-рецепторами.

58. Препарат по п.57, причем пептид, связывающийся с Y2-рецепторами, выбирают из группы, включающей пептид YY (PYY), нейропептид Y (NPY) и панкреатический пептид (РР).

59. Препарат по пп.57 и 58, содержащий также по крайней мере один агент, способствующий доставке через слизистые оболочки, выбираемый из группы, включающей:

а) солюбилизирующий агент;

b) агент, модифицирующий заряд;

с) агент, контролирующий рН;

d) агент, ингибирующий разлагающий фермент;

е) агент, являющийся муколитическим или удаляющим слизь;

f) цилиостатический агент;

g) агент, способствующий проникновению через мембраны, выбираемый из (i) поверхностно-активного агента, (ii) соли желчной кислоты, (iii) фосфолипидной добавки, смешанной мицеллы, липосомы или носителя, (iv) спирта, (v) енамина, (vi) соединения, являющегося донором NO, (vii) длинноцепочечной амфипатической молекулы, (viii) малого гидрофобного агента, способствующего проникновению, (ix) производного натрия или салициловой кислоты, (х) сложного эфира глицерина и ацетоуксусной кислоты, (xi) производного циклодекстрина или бета-циклодекстрина, (xii) жирной кислоты с цепью средней длины, (xiii) хелатирующего агента, (xiv) аминокислоты или ее соли, (xv) N-ацетиламинокислоты или ее соли, (xvi) фермента, разлагающего избранный компонент мембраны, (xvii) ингибитора синтеза жирных кислот, или (xviii) ингибитора синтеза холестерина или (xix) любой комбинации агентов, способствующих проникновению через мембраны по (i)-(xix);

h) агент, модулирующий физиологию эпителиальных стыков;

i) агент, являющийся вазодилататором;

j) агент, способствующий селективному транспорту; и

k) стабилизирующее средство доставки, носитель, основу или комплексообразователь.

60. Препарат по п.57, причем препарат является интраназальным.

61. Препарат по пп.57-60, причем препарат дополнительно содержит по крайней мере два полиола.

62. Препарат по п.61, причем полиолы представляют собой лактозу и сорбит.

63. Препарат по пп.57-62, причем препарат дополнительно содержит хелатирующий агент.

64. Препарат по п.63, причем хелатирующий агент представляет собой этилендиамин тетрауксусную кислоту (ЭДТА).

65. Препарат по пп.57-64, причем препарат дополнительно содержит солюбилизирующий агент.

66. Препарат по п.65, причем солюбилизирующий агент представляет собой циклодекстрин.

67. Препарат по пп.57-66, причем препарат дополнительно содержит поверхностно-активное вещество.

68. Препарат по п.67, причем поверхностно-активное вещество представляет собой L-a-фосфатидилхолин дидеканоил (DDPC).

69. Препарат по п.57, причем пептид, связывающийся с Y2-рецепторами, представляет собой PYY (3-36).

70. Препарат по п.68, причем препарат дополнительно содержит воду.

71. Препарат по п.69, причем рН препарата составляет приблизительно от 3 до 6.

72. Препарат по п.70, причем рН составляет 5,0+0,3.

73. Композиция пептида YY (PYY), содержащая солюбилизирующий агент, хелатирующий агент, полиол и пептид PYY, причем пептид PYY имеет аминокислотную последовательность, выбираемую из группы, включающей последовательности SEQ ID NO: 2, 3 и SEQ ID NO: 90-105.

74. Композиция PYY по п.73, причем композиция PYY содержит по крайней мере два полиола.

75. Композиция PYY по п.73, причем полиолы выбирают из группы, включающей сахарозу, маннит, сорбит, лактозу, L-арабинозу, D-эритрозу, D-рибозу, D-ксилозу, D-маннозу, трегалозу, D-галактозу, лактулозу, целлобиозу, гентибиозу, глицерин и полиэтиленгликоль.

76. Композиция PYY по п.74, причем полиолы представляют собой лактозу и сорбит.

77. Композиция PYY по п.73, причем хелатирующий агент представляет собой этилендиамин тетрауксусную кислоту (ЭДТА) или этиленгликоль тетрауксусную кислоту (ЭГТА).

78. Композиция PYY по п.77, причем хелатирующий агент представляет собой ЭДТА.

79. Композиция PYY по п.73, причем солюбилизирующий агент выбирают из группы, включающей циклодекстран, гидроксипропил-b-циклодекстран, сульфобутиловый эфир b-циклодекстрана и метил-b-циклодекстрин.

80. Композиция PYY по п.78, причем солюбилизирующий агент представляет собой циклодекстрин.

81. Композиция PYY по п.73, причем композиция дополнительно содержит поверхностно-активный агент.

82. Композиция PYY по п.80, причем поверхностно-активный агент выбирают из группы, включающей неионный полиоксиэтиленовый эфир, соли желчной кислоты, такие как гликохолат натрия (SGC), деоксихолат (DOC), производные фусидовой кислоты, тауродигидрофусидат натрия (STDHF), L-a-фосфатидилхолин дидеканоил (DDPC), полисорбат 80 и полисорбат 20, полиэтиленгликоль (ПЭГ), цетиловый спирт, поливинилпирролидон (PVP), поливиниловый спирт (PVA), ланолиновый спирт и сорбитан моноолеат.

83. Композиция PYY по п.81, причем поверхностно-активный агент представляет собой DDPC.

84. Композиция PYY по п.73, причем композиция является водной композицией PYY, дополнительно содержащей воду.

85. Композиция PYY по п.83, причем рН водной композиции составляет приблизительно от 3 до 6.

86. Композиция PYY по п.85, причем рН водной композиции PYY составляет 5,0+0,3.

87. Композиция PYY по п.73, причем пептид PYY содержит PYY(3-36) (SEQ ID NO: 2).

88. Композиция PYY, содержащая метил-b-циклодекстрин, ЭДТА, лактозу, сорбит, DDPC и пептид PYY, причем пептид PYY имеет аминокислотную последовательность, выбираемую из группы, включающей последовательности SEQ ID NO: 2, 3 и SEQ ID NO: 90-105.

89. Композиция PYY по п.88, причем пептид PYY содержит PYY(3-36) (SEQ ID NO: 2).

90. Водный препарат PYY(3-36), способный повышать концентрацию PYY(3-36) в плазме пациента по крайней мере на 5 пмоль в 1 л плазмы при введении указанному млекопитающему через слизистые оболочки дозы, содержащей по крайней мере 50 мкг PYY(3-36).

91. Препарат PYY(3-36) по п.90, причем указанному пациенту вводят интраназально приблизительно от 50 до 200 мкл препарата.

92. Водный препарат PYY(3-36), содержащий PYY(3-36) и солюбилизирующийагент, причем препарат, по существу, свободен от стабилизатора, являющегося полипептидом или белком.

93. Препарат PYY(3-36) по п.91, причем препарат дополнительно содержит хелатирующий агент, один или более полиолов и имеет рН приблизительно от 3 до 6,5.

94. Препарат PYY(3-36) по п.92, причем препарат дополнительно содержит поверхностно-активный агент.

95. Препарат PYY(3-36) по п.93, причем рН препарата составляет приблизительно 5,0.

96. Препарат PYY(3-36) по п.93, причем препарат не содержит эндотоксин.

97. Препарат PYY(3-36) по п.92, причем препарат содержит по крайней мере два полиола.

98. Препарат PYY(3-36) по п.96, причем полиолы выбирают из группы, включающей сахарозу, маннит, сорбит, лактозу, L-арабинозу, D-эритрозу, D-рибозу, D-ксилозу, D-маннозу, трегалозу, D-галактозу, лактулозу, целлобиозу, гентибиозу, глицерин и полиэтиленгликоль.

99. Препарат PYY(3-36) по п.97, причем полиолы представляют собой лактозу и сорбит.

100. Препарат PYY(3-36) no п.92, причем хелатирующий агент представляет собой этилендиамин тетрауксусную кислоту (ЭДТА) или этиленгликоль тетрауксусную кислоту (ЭГТА).

101. Препарат PYY(3-36) по п.100, причем хелатирующий агент представляет собой ЭДТА.

102. Препарат PYY(3-36) по п.92, причем солюбилизирующий агент выбирают из группы, включающей циклодекстран, гидроксипропил-b-циклодекстран, сульфобутиловый эфир b-циклодекстрана и метил-b-циклодекстрин.

103. Препарат PYY(3 -36) по п.101, причем солюбилизирующим агентом является циклодекстрин.

104. Препарат PYY(3-36) по п.92, причем поверхностно-активный агент выбирают из группы, включающей неионный полиоксиэтиленовый эфир, соли желчной кислоты, такие как гликохолат натрия (SGC), деоксихолат (DOC), производные фусидовой кислоты, тауродигидрофусидат натрия(STDHF), L-a-фосфатидилхолин дидеканоил (DDPC), полисорбат 80 и полисорбат 20, полиэтиленгликоль (ПЭГ), цетиловый спирт, поливинилпирролидон (PVP), поливиниловый спирт (PVA), ланолиновый спирт и сорбитан моноолеат.

105. Препарат PYY(3-36) по п.103, причем поверхностно-активный агент представляет собой DDPC.

106. Препарат PYY(3-36) по п.92, причем препарат дополнительно содержит консервант, выбираемый из группы, включающей хлорбутанол и бензалкония хлорид.

107. Препарат PYY(3-36) по п.105, причем консервант представляет собой хлорбутанол.

108. Препарат PYY(3-36) по п.103 или 107, причем интраназально вводят приблизительно от 50 до 200 мкл препарата.

109. Препарат PYY(3-36) no п.92, причем время достижения максимальной концентрации в плазме после введения указанного препарата через слизистые оболочки Тmax для указанного пептида составляет менее 30 мин.

110. Препарат PYY(3-36) по п.109, причем Тmax составляет приблизительно 20 мин.

111. Препарат PYY(3-36) по п.109, причем введение указанного препарата через слизистые оболочки повышает концентрацию указанного пептида в плазме, период полувыведения пептида составляет около 55 мин.

112. Водный препарат PYY(3-36), содержащий пептид PYY(3-36), причем однократное введение указанного препарата через слизистые оболочки приводит к величине Сmax более 300 пг/мл.

113. Препарат PYY(3-36) по п.112, причем величина Сmax больше 75 пмоль/л.

114. Препарат PYY(3-36) по п.112, причем взаимодействие слоя эпителиальных клеток слизистой оболочки с указанным препаратом снижает электрическое сопротивление через указанный слой по крайней мере в 100 раз.

115. Препарат PYY(3-36) по п.114, причем указанный слой эпителиальных клеток слизистой оболочки представляет собой монослой бронхиальных клеток.

116. Препарат PYY(3-36) по п.112, причем взаимодействие слоя эпителиальных клеток слизистой оболочки с указанным препаратом повышает прохождение пептида через указанный слой по крайней мере в 30 раз по сравнению с простыми буферными растворами.

117. Препарат PYY(3-36) по п.116, причем прохождение пептида через указанный слой по крайней мере в 100 раз выше по сравнению с простыми буферными растворами.

118. Препарат PYY(3-36) по п.117, причем указанный слой эпителиальньк клеток слизистой оболочки представляет собой монослой бронхиальных клеток.

119. Препарат PYY(3-36) по п.112, причем стабильность пептида в препарате составляет по крайней мере 96% в течение одного месяца при температуре 5 или 25шС.

120. Композиция пептида YY (PYY), содержащая пептид PYY и стабилизатор, отличный от полипептида или белка, причем пептид PYY имеет аминокислотную последовательность, выбираемую из группы, включающей последовательности SEQ ID NO: 2, 3 и SEQ ID NO: 90-105.

121. Препарат PYY(3-36), содержащий воду, пептид, связывающийся с Y2-рецепторами, один или более полиолов и поверхностно-активный агент, причем рН препарата составляет приблизительно от 3,0 до 6,5 и препарат, по существу, свободен от стабилизатора, являющегося полипептидом или белком.

122. Препарат по п.121, причем полиол выбирают из группы, включающей лактозу, сорбит, трегалозу, сахарозу, маннозу и мальтозу и их производные и гомологи.

123. Препарат PYY(3-36) по п.121, причем поверхностно-активный агент выбирают из группы, включающей неионный полиоксиэтиленовый эфир, соли желчных кислот, такие как гликохолат натрия (SGC), деоксихолат (DOC), производные фусидовой кислоты, тауродигидрофусидат натрия (STDHF), L-a-фосфатидилхолин дидеканоил (DDPC), полисорбат 80 и полисорбат 20, полиэтиленгликоль (ПЭГ), цетиловый спирт, поливинилпирролидон (PVP), поливиниловый спирт (PVA), ланолиновый спирт и сорбитан моноолеат.

124. Препарат PYY(3-36) по пп.121 и 122, причем препарат дополнительно содержит солюбилизирующий агент и хелатирующий агент.

125. Препарат PYY(3-36) по п.123, причем солюбилизирующий агент выбирают из группы, включающей циклодекстран, гидроксипропил-b-циклодекстран, сульфобутиловый эфир b-циклодекстрана и метил-b-циклодекстрин.

126. Композиция PYY, содержащая воду, цитрат натрия, лимонную кислоту, метил-b-циклодекстрин, ЭДТА, лактозу, сорбит, DDPC и PYY(3-36) (SEQ ID NO: 2), причем рН препарата составляет приблизительно 5,0+0,3.

127. Композиция PYY по п.126, дополнительно содержащая консервант, выбираемый из группы, включающей хлорбутанол и бензалкония хлорид.

128. Композиция по п.17, причем консервант представляет собой хлорбутанол.

129. Композиция PYY, содержащая воду, хлорбутанол, цитрат натрия, лимонную кислоту, метил-b-циклодекстрин, ЭДТА, лактозу, сорбит, DDPC и PYY(3-36) (SEQ ID NO: 2), причем рН препарата составляет приблизительно 5,0+0,3.

 

Текст

Смотреть все

008829 Предшествующий уровень техники Ожирение и ассоциированные с ним нарушения представляют собой распространенные и очень серьезные проблемы общественного здравоохранения в Соединенных Штатах и во всем мире. Ожирение верхней части тела является наиболее известным фактором риска сахарного диабета типа 2 и существенным фактором риска сердечно-сосудистых заболеваний. Ожирение является признанным фактором риска гипертонии, атеросклероза, застойной сердечной недостаточности, инсульта, заболевания желчного пузыря, остеоартрита, апноэ во сне, репродуктивных нарушений, таких как синдром поликистоза яичников, онкологических заболеваний груди, простаты и толстой кишки, и учащения осложнений общей анестезии. Оно снижает продолжительность жизни и создает серьезный риск заболеваний, сопутствующих вышеуказанным, а также таких нарушений, как инфекции, варикозные вены, акантокератодермия, экзема, непереносимость физических нагрузок, резистентность к инсулину, гипертоническая гиперхолестеринемия, желчекаменная болезнь, ортопедические повреждения и тромбоэмболическое заболевание. Ожирение является также фактором риска группы состояний, которую называют синдромом резистентности к инсулину или "Синдромом X". Было показано, что определенные пептиды, которые связываются с Y2-рецептором, при периферическом введении млекопитающему индуцируют потерю массы. Пептидами, связывающимися с Y2 рецептором, являются нейропептиды, которые связываются с Y2-рецептором. Нейропептиды представляют собой малые пептиды, происходящие из больших белков-предшественников, синтезируемых пептидергическими нейронами и эндокринными/паракринными клетками. Часто предшественники содержат многочисленные биологически активные пептиды. В мозге существует большое разнообразие нейропептидов, вызванное альтернативным сплайсингом первичных генных транскриптов и дифференциальным процессингом предшественников. Рецепторы нейропептидов служат для дискриминации между лигандами и для активации надлежащих сигналов. Пептиды, связывающиеся с Y2-рецепторами, принадлежат к семейству пептидов, включающему в себя пептид YY (PYY), нейропептид Y (NPY) и панкреатический пептид (РР).NPY представляет собой пептид из 36 аминокислот и наиболее обильным нейропептидом из идентифицированных в мозге млекопитающих. NPY является важным регулятором, как в центральной, так и в периферической нервных системах и влияет на разнообразные физиологические параметры, включая влияние на психомоторную активность, потребление пищи, центральную эндокринную секрецию и вазоактивность в сердечно-сосудистой системе. Высокие концентрации NPY обнаружены в симпатических нервах, снабжающих коронарную, церебральную и почечную сосудистые системы и вносящих вклад в вазоконстрикцию. Сайты связывания NPY были идентифицированы в разных тканях, в том числе в селезенке, кишечных мембранах, мозге, гладких мышцах аорты, почках, семенниках и плаценте. Фармакологию рецепторов нейропептида Y (NPY) в настоящее время определяют структурнофункциональные отношения в пределах семейства панкреатического полипептида. Это семейство включает в себя NPY, который синтезируется главным образом в нейронах; PYY, который синтезируется главным образом эндокринными клетками в кишечнике, и РР, который синтезируется главным образом эндокринными клетками в поджелудочной железе. Эти пептиды, состоящие из приблизительно 36 аминокислот, имеют компактную спиральную структуру, содержащую "РР-складку" в середине пептида. Специфические особенности включают в себя полипролиновую спираль, состоящую из остатков 1-8,бета-поворот, состоящий из остатков 9-14, альфа-спираль, состоящую из остатков 15-30, и выступающий наружу С-конец, состоящий из остатков 30-36, и карбоксиконцевой амид, который считают критическим для биологической активности. Эти пептиды были использованы для определения по меньшей мере пяти подтипов рецепторов, известных как Y1, Y2, Y3, Y4 и Y5. В распознавании Y1-рецептора пептидом NPY участвуют как N-, так и С-концевые области пептида; замена Gln34 на Pro34 переносится довольно хорошо. Распознавание Y2-рецептора пептидом NPY зависит, главным образом, от четырех С-концевых остатков пептида (Arg33 - Gln34 - Arg35 - Тyr36 -NH2), которым предшествует амфипатическая альфа-спираль; замена Gln34 на Pro34 не является хорошо переносимой. Одной из ключевых фармакологических особенностей, которые различают Y1 и Y2, является тот факт, что Y2-рецептор (а не Y1-рецептор) имеет высокое сродство к карбоксиконцевому фрагменту пептида NPY, NPY-(13-36) и к фрагменту PYY22-36 пептида PYY. Было показано, что пептид, состоящий из 36 аминокислот, названный пептидом YY(1-36) [PYY(136)] [YPIKPEAPGEDASPEELNRYYASLRHYLNLVTRQRY, SEQ ID: 1], при введении индивиду путем периферической инъекции вызывает потерю массы и, таким образом, его можно использовать в качестве лекарственного средства для лечения ожирения и связанных с ним заболеваний, Morley, J. Neuropsychobiology 21: 22-30 (1989). Позже было обнаружено, что для получения этого эффекта PYY связывается сY2-рецептором и что связывание Y2-агониста с Y2-рецептором вызывает снижение потребления углеводов, белков и количества пищи, Leibowitz, S.F. et al. Peptides, 12:1251-1260 (1991). Альтернативной молекулярной формой PYY является PYY(3-36) IKPEAPGEDASPEELNRYYASLRHYLNLVTRQRY [SEQ ID: 2], Eberlein, Eysselein et al. Peptides 10: 797-803, 1989. Этот фрагмент составляет приблизительно 40% суммарной PYY-подобной иммунореактивности в кишечных экстрактах человека и собаки и приблизительно от 36% суммарной иммунореактивности PYY в плазме натощак до показателя, несколько больше-1 008829 го, чем 50% после приема пищи. Он, видимо, является продуктом расщепления PYY дипептидилпептидазой-IV (DPP4). Сообщается, что PYY3-36 является селективным лигандом Y2- и Y5-рецепторов, которые оказываются фармакологически уникальными в своем предпочтении усеченных по N-концу (то есть,С-концевых фрагментов) аналогов NPY. Также было показано, что фрагмент PYY, имеющий только остатки 22-36, все равно связывается с Y2-рецептором. Однако, если любая часть карбоксиконца этого пептида отщеплена, пептид теряет способность связываться с Y2-рецептором. Таким образом, PYYагонистом является пептид, который имеет частичную последовательность полноразмерного PYY и способен связываться с Y2-рецептором в аркуатном ядре гипоталамуса. Здесь и далее термин "PPY" относится к полноразмерному PPY и любому фрагменту PPY, связывающемуся с рецептором Y2. Известно, что PYY и PYY3-36 можно вводить внутривенной инфузией или инъекцией для лечения угрожающей жизни гипотонии, которая случается при шоке, особенно вызванном эндотоксинами (патент США 4839343), для ингибирования пролиферации панкреатических опухолей у млекопитающих при перфузии, парентеральном, внутривенном или подкожном введении и при имплантации (патент США 5574010), для лечения ожирения (Morley, J. Neuropsychobiology 21:22-30 (1989) и заявка на патент США 20020141985). Также заявлено, что PYY можно вводить парентеральным, пероральным, интраназальным, ректальным и местным путями субъектам, представляющим собой домашнее животное или человека, в количестве, эффективном для увеличения прибавления массы вышеуказанного субъекта путем усиления желудочно-кишечной абсорбции натрийзависимого котранспортируемого питательного вещества(патент США 5912227). Однако для лечения ожирения и связанных с ним заболеваний, в том числе диабета, способ введения был ограничен внутривенной инфузией при отсутствии эффективных препаратов, оптимизированных для альтернативного введения PYY3-36. Ни одна из этих методик по прежнему уровню техники не обеспечивает составов, которые содержат PYY или PYY(3-36) в комбинации с наполнителями, предназначенными для усиления доставки через слизистые оболочки (то есть, интраназальной, защечной, пероральной доставки), а также не описывает значение не содержащих эндотоксин препаратов пептида, связывающегося с Y2-рецепторами, для неинфузионного введения. Таким образом,имеется необходимость в разработке препаратов и способов для введения PYY3-36. Краткое описание изобретения Данное изобретение отвечает вышеуказанным потребностям и удовлетворяет дополнительным целям и обеспечивает преимущества предоставлением новых эффективных способов и композиций для доставки через слизистые, особенно через нос (интраназально), пептидов, связывающихся с Y2 рецепторами, таких как PYY, панкреатический пептид (РР) и NPY, для лечения ожирения и для индукции сытости у индивида с целью способствовать потере массы у этого индивида и предотвращать или излечивать диабет. В определенных аспектах этого изобретения пептид, связывающийся с Y2 рецепторами, доставляют в препаратах в слизистую носовой полости так, что он может увеличивать концентрацию пептида, связывающегося с Y2-рецепторами, по меньшей мере на 5 пикомолей, предпочтительно по меньшей мере на 10 пикомолей, в плазме крови млекопитающего, при интраназальном введении дозы препарата агониста Y2-рецептора. Более того, предпочтительные препараты должны быть способными повышать концентрацию пептида, связывающегося с Y2-рецепторами, в плазме млекопитающего на 10 пикомолей, предпочтительно на 20 пикомолей, при интраназальном введении пептида, связывающегося с Y2-рецептором. При интраназальном введении 150 мкг предпочтительного препарата он должен повысить концентрацию агониста Y2-рецептора в плазме млекопитающего по меньшей мере на 40 пикомолей в литре плазмы. При интраназальном введении 200 мкг пептида, связывающегося с Y2 рецепторами, препараты по данному изобретению индуцируют увеличение количества пептида, связывающегося с Y2-рецепторами по меньшей мере на 80 пикомолей в литре плазмы. Предпочтительно пептид, связывающийся с Y2-рецепторами, является пептидом РР, PYY или NPY,а млекопитающим является человек. В наиболее предпочтительном варианте осуществления пептид, связывающийся с Y2-рецепторами, является пептидом PYY, предпочтительно PYY(3-36), а млекопитающим является человек. Данное изобретение также относится препарату пептида, связывающегося с Y2-рецепторами, который способен повышать концентрацию пептида, связывающегося с Y2-рецепторами, в плазме крови млекопитающего по меньшей мере на 5 пМ, при введении млекопитающему дозы, содержащей по меньшей мере 50 мкг пептида, связывающегося с Y2-рецепторами. Данное изобретение также относится к препарату пептида, связывающегося с Y2-рецепторами, который способен повышать концентрацию пептида, связывающегося с Y2-рецепторами, в плазме крови млекопитающего по меньшей мере на 20 пМ, при введении млекопитающему дозы, содержащей по меньшей мере 100 мкг пептида, связывающегося с Y2-рецепторами. Данное изобретение также относится к препарату пептида, связывающегося с Y2-рецепторами, который при интраназальном введении млекопитающему способен повышать концентрацию пептида, связывающегося с Y2-рецепторами, в плазме крови млекопитающего по меньшей мере на 30 пМ, при введении дозы, содержащей по меньшей мере 150 мкг пептида, связывающегося с Y2-рецепторами. Предпочтительно млекопитающим является человек.-2 008829 Данное изобретение также относится к препарату пептида, связывающегося с Y2-рецепторами, который при интраназальном введении млекопитающему способен повышать концентрацию пептида, связывающегося с Y2-рецепторами, в плазме крови млекопитающего по меньшей мере на 60 пМ, при введении дозы, содержащей по меньшей мере 200 мкг пептида, связывающегося с Y2-рецепторами. Предпочтительно млекопитающим является человек. Данное изобретение также направлено на интраназальный препарат агониста Y2-рецептора, являющийся по существу свободным от белков или полипептидов, стабилизирующих этот препарат. В частности, предпочтительный препарат свободен от таких белков, как альбумин и образованные из коллагена белки, такие как желатин. В других аспектах данного изобретения препарат пептида, связывающегося с Y2-рецепторами, для доставки через слизистые содержит пептид, связывающийся с Y2-рецепторами, воду и солюбилизирующий агент, имеющий рН от 3 до 6,5. В предпочтительном варианте осуществления солюбилизирующим агентом является циклодекстрин. В другом варианте осуществления данного изобретения препарат пептида, связывающегося с Y2 рецепторами, для доставки через слизистые оболочки содержит пептид, связывающийся с Y2 рецепторами, воду, солюбилизирующий агент, предпочтительно циклодекстрин, и по меньшей мере один полиол, предпочтительно 2 полиола. В альтернативных вариантах осуществления препарат может содержать одно или все из нижеследующего: хелатирующий агент, поверхностно-активный агент и забуферивающий агент. В другом варианте осуществления данного изобретения препарат содержит пептид, связывающийся с Y2-рецепторами, воду, хелатирующий агент и солюбилизирующий агент. В еще одном варианте осуществления данного изобретения препарат содержит пептид, связывающийся с Y2-рецепторами, воду и хелатирующий агент, имеющий рН от 3 до 6,5. В еще одном варианте осуществления данного изобретения препарат содержит пептид, связывающийся с Y2-рецепторами, воду, хелатирующий агент и по меньшей мере один полиол, предпочтительно два полиола. Согласно дополнительным вариантам осуществления препараты могут включать в себя один или несколько из нижеследующих агентов: поверхностно-активный агент, солюбилизирующий агент и забуферивающий агент. В еще одном варианте осуществления данного изобретения препарат содержит пептид, связывающийся с Y2-рецепторами, воду и по меньшей мере два полиола, такие как лактоза и сорбит. Дополнительные агенты, которые можно добавлять к препарату, включают в себя, без ограничения, солюбилизирующий агент, хелатирующий агент, один или более забуферивающих агентов и поверхностно-активный агент. Усиление интраназальной доставки агониста пептида, связывающегося с Y2-рецепторами, в соответствии со способами и композициями по этому изобретению делает возможным эффективное фармацевтическое применение этих агентов для лечения множества разных заболеваний и состояний у млекопитающих. Данное изобретение отвечает этой потребности, делая возможным жидкий или обезвоженный препарат пептида, связывающегося с Y2-рецепторами, причем этот препарат по существу свободен от стабилизатора, являющегося полипептидом или белком. Жидкий препарат PYY содержит воду, PYY и по меньшей мере одну из нижеследующих добавок, выбранных из группы, состоящей из полиолов, поверхностно-активных агентов, солюбилизирующих агентов и хелатирующих агентов. Величина рН препарата предпочтительно составляет приблизительно от 3 до 7,0, предпочтительно приблизительно от 4,5 до 6,0,наиболее предпочтительно около 5,00,03. Еще одним вариантом осуществления данного изобретения является водный препарат пептида, связывающегося с Y2-рецепторами, по данному изобретению, содержащий воду, пептид, связывающийся сY2-рецепторами, полиол и поверхностно-активный агент, причем этот препарат имеет рН приблизительно от 3 до 6,5 и, по существу, свободен от стабилизатора, являющегося белком или полипептидом. Еще одним вариантом осуществления данного изобретения является водный препарат пептида, связывающегося с Y2-рецепторами, содержащий воду, пептид, связывающийся с Y2-рецепторами, полиол и солюбилизирующий агент, причем этот препарат имеет рН приблизительно от 3,0 до 6,5 и, по существу,свободен от стабилизатора, который является белком или полипептидом. Еще одним вариантом осуществления данного изобретения является водный препарат пептида, связывающегося Y2-рецепторами, содержащий воду, пептид, связывающийся с Y2-рецепторами, солюбилизирующий агент и поверхностно-активный агент, причем этот препарат имеет рН приблизительно от 3,0 до 6,5 и по существу свободен ог стабилизатора, который является белком или полипептидом. Другим вариантом осуществления этого изобретения является водный препарат пептида, связывающегося с Y2-рецепторами, содержащий воду, пептид, связывающийся с Y2-рецепторами, солюбилизирующий агент, полиол и поверхностно-активный агент, причем этот препарат имеет рН приблизительно от 3,0 до 6,5 и по существу свободен от стабилизатора, который является белком или полипептидом. В другом аспекте данного изобретения стабильный водный препарат обезвоживают с получением обезвоженного препарата пептида, связывающегося с Y2-рецепторами, причем этот препарат содержит-3 008829 пептид, связывающийся с Y2-рецепторами, и, по меньшей мере, одну из нижеследующих добавок, выбираемых из группы, состоящей из полиолов, поверхностно-активных агентов, солюбилизирующих агентов и хелатирующих агентов, причем вышеуказанный обезвоженный препарат пептида, связывающегося сY2-рецепторами, по существу свободен от стабилизатора, который является белком или полипептидом,таким как альбумин, коллаген или произведенный из коллагена белок, такой как желатин. Обезвоживание может быть достигнуто различными способами, такими как лиофилизация, распылительная сушка,индуцированная солью преципитация и сушка, вакуумная сушка, роторное выпаривание или преципитация сверхкритическим СО 2. В одном варианте осуществления обезвоженный пептид, связывающийся с Y2-рецепторами, содержит пептид, связывающийся с Y2-рецепторами, полиол и солюбилизирующий агент, причем этот препарат по существу свободен от стабилизатора, которым является белок. В другом варианте осуществления обезвоженный препарат пептида, связывающегося с Y2 рецепторами, содержит пептид, связывающийся с Y2-рецепторами, полиол и поверхностно-активный агент, причем препарат пептида, связывающегося с Y2-рецепторами, по существу, свободен от стабилизатора, который является белком или полипептидом. В другом варианте осуществления обезвоженный препарат пептида, связывающегося с Y2 рецепторами, содержит пептид, связывающийся с Y2-рецепторами, поверхностно-активный агент и солюбилизирующий агент, причем препарат пептида, связывающегося с Y2-рецепторами, по существу свободен от стабилизатора, которым является белок или полипептид. В еще одном варианте осуществления данного изобретения обезвоженный препарат пептида, связывающегося с Y2-рецепторами, содержит пептид, связывающийся с Y2-рецепторами, полиол, поверхностно-активный агент и солюбилизирующий агент, причем препарат пептида, связывающегося с Y2 рецепторами, по существу свободен от стабилизатора, который является белком или полипептидом. Можно использовать любой солюбилизирующий агент, но предпочтительный агент выбирают из группы, которую составляют гидроксипропилциклодекстран, сульф-бутиловый эфир -циклодекстрана, метилциклодекстрин и хитозан. Вообще, полиол выбирают из группы, состоящей из лактозы, сорбита, трегалозы, сахарозы, маннозы и мальтозы и их производных и гомологов. Подходящий поверхностно-активный агент выбирают из группы, состоящей из L-фосфатидилхолиндидеканоила (DDPC), полисорбата 20 (Tween 20), полисорбата 80 (Tween 80), полиэтиленгликоля (ПЭГ), цетилового спирта, поливинилпирролидона (PVP), поливинилового спирта (PVA),ланолинового спирта и сорбитанмоноолеата. В предпочтительном препарате препарат пептида, связывающегося с Y2-рецепторами, также содержит хелатирующий агент, такой как этилендиаминтетрауксусная кислота (ЭДТА) или этиленгликольтетрауксусная кислота (ЭГТА). Также к препарату можно добавлять консервант, такой как хлорбутанол или хлорид бензалкония для ингибирования микробного роста. рН обычно регулируют при использовании буфера, такого как цитрат натрия с лимонной кислотой и ацетат натрия с уксусной кислотой. Альтернативным буфером может быть уксусная кислота с ацетатом натрия или янтарная кислота с гидроксидом натрия. Предпочтительными пептидами, связывающимися с Y2-рецепторами, являются пептиды PYY, РР или NPY, предпочтительно пептид PYY(3-36). Данное изобретение также предусматривает препарат, в котором концентрация пептида, связывающегося с Y2-рецепторами, составляет от 0,1 до 15,0 мг/мл, предпочтительно от 1,0 до 2 мг/мл, и величина рН водного раствора составляет от 3,0 до 6,5, предпочтительно около 5,00,3. Данное изобретение дополнительно включает в себя препарат пептида, связывающегося с Y2 рецепторами, причем концентрация полиола находится между 0,1 и 10% (масса/объем) и, дополнительно,концентрация полиола находится в диапазоне приблизительно от 0,1 до 3% (масса/объем). Данное изобретение также включает в себя препарат, в котором концентрация поверхностноактивного агента находится приблизительно между 0,00001 и 5% (масса/объем), причем концентрация поверхностно-активного агента находится приблизительно между 0,0002 и 0,1% (масса/объем). Это изобретение также включает в себя препарат, в котором концентрация солюбилизирующего агента составляет от 1 до 10% (масса/объем), причем концентрация солюбилизирующего агента составляет от 2 до 5% (масса/объем). Готовый раствор можно фильтровать, подвергать сублимационной сушке, лиофилизировать при использовании способов, хорошо известных обычному специалисту в данной области, и следуя инструкциям изготовителя лиофилизирующего оборудования. Таким образом получают обезвоженный препарат пептида, связывающегося с Y2-рецепторами, по существу свободный от стабилизатора, который является белком. В еще одном варианте осуществления данного изобретения препарат пептида, связывающегося сY2 -рецепторами, содержит пептид, связывающийся с Y2-рецепторами, и фармацевтически приемлемый носитель, причем препарат пептида, связывающегося с Y2-рецепторами, имеет по меньшей мере на 1%,-4 008829 предпочтительно на 3% и наиболее предпочтительно по меньшей мере на 6% более высокую проникающую способность в анализе проникновения в ткань in vitro, чем контрольный препарат, состоящий из воды, хлорида натрия, буфера и пептида, связывающегося с Y2-рецепторами, при определении анализом трансэпителиального электрического сопротивления, описанным в примерах 2 и 7. В предпочтительном варианте осуществления препарат, связывающийся с Y2 рецепторами, дополнительно содержит по меньшей мере один наполнитель, выбранный из группы, состоящей из поверхностно-активного агента,солюбилизирующего агента, полиола и хелатирующего агента. Предпочтительно пептидом, связывающимся с Y2-рецепторами, является пептид PYY, пептид NPY или пептид PP. В еще одном варианте осуществления данного изобретения предложен препарат пептида, связывающегося с Y2-рецепторами, который способен повышать концентрацию пептида, связывающегося сY2-рецепторами, в плазме млекопитающего по меньшей мере на 5, предпочтительно на 10, 20 40, 60, 80 или более пикомолей в литре плазмы, при интраназальном введении вышеуказанному млекопитающему 100 мкл препарата. В вариантах осуществления, являющихся примерами, способствующие доставке способы и композиции по данному изобретению обеспечивают терапевтически эффекгивную доставку агониста пептида,связывающегося с Y2-рецепторами, через слизистые оболочки для предотвращения или лечения ожирения и нарушений питания у млекопитающих. В одном аспекте этого изобретения предложены фармацевтические препараты, подходящие для введения через нос, которые содержат терапевтически эффективное количество пептида, связывающегося с Y2-рецепторами, и один или более агентов, способствующих интраназальной доставке, описанных здесь, причем эти препараты эффективны в способе интраназальной доставки через слизистые оболочки по этому изобретению для предотвращения начала или прогрессии ожирения или нарушений питания у млекопитающего. Доставка, осуществляемая через слизистые оболочки носовой полости, терапевтически эффективного количества агониста пептида, связывающегося с Y2-рецепторами, и одного или нескольких из агентов, способствующих интраназальной доставке, приводит к повышению терапевтических уровней агониста пептида, связывающегося с Y2-рецепторами, в субъекте и ингибирует потребление пищи у млекопитающего, что снижает симптомы ожирения или нарушения питания. Способствующие доставке способы и композиции по данному изобретению обеспечивают терапевтически эффективную доставку, осуществляемую через слизистые, пептида, связывающегося с Y2 рецепторами, для предотвращения или лечения множества разных заболеваний и состояний у субъектов,представляющих собой млекопитающее. Пептиды, связывающиеся с Y2-рецепторами, можно вводить множеством разных путей доставки через слизистые, например приведением пептида, связывающегося сY2-рецепторами, в контакт с эпителием слизистых оболочек носовой полости, эпителием слизистых оболочек бронхов или легких, щечной поверхностью полости рта или с поверхностью слизистых оболочек полости рта и тонкого кишечника. В вариантах осуществления, являющихся примерами, способы и композиции предназначены или составлены для интраназальной доставки (например, доставки через слизистые оболочки носовой полости или интраназальной доставки через слизистые оболочки). В одном аспекте этого изобретения предложены фармацевтические препараты, подходящие для интраназального введения, содержащие терапевтически эффективное количество агониста пептида, связывающегося с Y2-рецепторами, и один или несколько агентов, способствующих интраназальной доставке,описанных здесь, причем эти препараты эффективны в способе доставки через слизистые оболочки носовой полости по этому изобретению для предотвращения начала или прогрессии ожирения, диабета,рака, или недостаточного питания или похудания, связанных с онкологическим заболеванием, у субъекта, представляющего собой млекопитающее, или для облегчения одного или нескольких из хорошо клинически распознаваемых симптомов ожирения, а также для лечения болезни Альцгеймера, карциномы толстой кишки, аденокарциномы толстой кишки, панкреатической карциномы, панкреатической аденокарциномы, карциномы груди. В другом аспекте этого изобретения фармацевтические препараты и способы направлены на введение агониста пептида, связывающегося с Y2-рецепторами, в комбинации с сукцинатом витамина Е. Агонист пептида, связывающийся с Y2-рецепторами, в комбинации с сукцинатом витамина Е можно вводить для облегчения симптомов или предотвращения начала или снижения частоты и тяжести рака, например,аденокарциномы толстой кишки, панкреатической аденокарциномы или рака груди. В другом аспекте этого изобретения неожиданно было обнаружено, что применение свободных от эндотоксина пептидов, связывающихся с Y2-рецепторами, например PYY(3-36), дает увеличение доставки через слизистые при сравнении с пептидами, у которых эндотоксин не удален. Применение свободных от эндотоксина пептидов, связывающихся с Y2-рецепторами, в фармацевтических препаратах слелало возможным введение неинфузионными путями, включающими в себя доставку через слизистые оболочки носа, рта, легких, влагалища, прямой кишки и тому подобные. Вышеуказанные препараты пептида, связывающегося с Y2-рецепторами, для доставки, осуществляемой через слизистые оболочки, и способы получения и способы доставки по этому изобретению обеспечивают улучшенную доставку через слизистые оболочки пептидов, связывающихся с Y2 рецепторами, субъектам, представляющим собой млекопитающее. Эти композиции и способы могут-5 008829 включать в себя комбинационный препарат или координированное введение одного или нескольких из пептидов, связывающихся с Y2-рецепторами, с одним или несколькими из агентов, способствующих доставке через слизистые оболочки. К агентам, способствующим доставке через слизистые оболочки,выбираемым для этих препаратов и способов, относятся: (а) солюбилизирующие агенты; (б) модифицирующие заряд агенты; (в) агенты контроля рН; (г) ингибиторы разлагающих ферментов; (д) муколитические или удаляющие слизь агенты; (е) цилиостатические агенты;агенты, способствующие проникновению через мембраны (например, (i) поверхностно-активный агент, (ii) соль желчной кислоты, (ii) фосфолипидная или жирнокислотная добавка, смешанная мицелла, липосома или носитель, (iii) спирт, (iv) енамин, (v) соединение, являющееся донором NO, (vi) длинноцепочечная амфипатическая молекула (vii) малый гидрофобный агент, способствующий проникновению; (viii) производное натрия или салициловой кислоты; (iх) глицериновый эфир ацетоуксусной кислоты (х) производное циклодекстрина или бетациклодекстрина, (xi) жирная кислота с цепью средней длины, (xii) хелатирующий агент, (xiii) аминокислота или ее соль, (xiv) N-ацетиламинокислота или ее соль, (xv) фермент, разлагающий выбранный компонент мембраны, (xvi) ингибитор синтеза жирных кислот, (xvii) ингибитор синтеза холестерина; или(xviii) любая комбинация агентов, способствующих проникновению через мембраны по (i)-(xvii; (ж) агенты, модулирующие физиологию эпителиальных стыков, такие как стимуляторы оксида азота (NO),хитозан и производные хитозана; (з) вазодиляторные агенты; (и) агенты, способствующие селективному транспорту; и (к) стабилизирующие средства доставки, носители, вспомогательные агенты или комплексобразующие агенты, с которыми пептид(ы), связывающий(е)ся с Y2-рецепторами, эффективно комбинируются, ассоциируются, содержатся, инкапсулируются или связываются с целью стабилизации активного агента, способствующего доставке через слизистые оболочки. В различных вариантах осуществления этого изобретения пептид YY комбинируют с одним, двумя,тремя, четырьмя или более агентами, способствующими доставке через слизистые оболочки, указанными в пунктах (а)-(к), выше. Эти агенты, способствующие доставке через слизистые, можно смешивать, по отдельности или вместе, с пептидом YY, или иначе комбинировать с ним в фармацевтически приемлемом препарате или средстве доставки. Препарат пептида YY с одним или более чем одним из агентов,способствующих доставке через слизистые, в соответствии с данным здесь описанием (как вариант,включающий в себя любую комбинацию двух или более агентов, способствующих доставке через слизистые, выбираемых из вышеуказанных пунктов (а)-(к обеспечивает увеличение биологической доступности пептида YY после его доставки через поверхность слизистых оболочек субъекта, представляющего собой млекопитающее. Таким образом, данное изобретение представляет собой способ для подавления аппетита, для способствования потере массы, для уменьшения потребления пищи или для лечения ожирения и/или диабета у млекопитающего, причем при этом способе вводят через слизистые оболочки препарат, содержащий пептид, связывающийся с Y2-рецепторами, так что, когда через слизистые оболочки вводят млекопитающему 50 мкг Y2-рецептора, концентрация пептида, связывающегося с Y2-рецепторами, в плазме млекопитающего увеличивается по меньшей мере на 5 пикомолей, предпочтительно по меньшей мере на 10 пикомолей в литре плазмы. Примеры таких препаратов раскрыты выше. Данное изобретение дополнительно обеспечивает применение пептида, связывающегося с Y2 рецепторами, с целью получения медикамента для осуществляемого через слизистые оболочки введения пептида, связывающегося с Y2-рецепторами, для подавления аппетита, для способствования потере массы, для уменьшения потребления пищи или для лечения ожирения у млекопитающего, причем, когда млекопитающему вводят через слизистые около 50 мкг Y2-рецептора, концентрация пептида, связывающегося с Y2-рецепторами, в плазме млекопитающего увеличивается по меньшей мере на 5 пикомолей в литре плазмы. Когда млекопитающему интраназально вводят 100 мкг пептида, связывающегося с Y2 рецепторами, концентрация агониста Y2-рецептора увеличивается по меньшей мере на 20 пикомолей в литре плазмы у млекопитающего. Доза пептида YY в фармацевтических препаратах по данному изобретению, эффективная для доставки через слизистые оболочки, содержит, например, приблизительно от 0,001 до 100 пикомолей на кг массы тела, приблизительно от 0,01 до 10 пикомолей на кг массы тела или приблизительно от 0,1 до 5 пикомолей на кг массы тела. В дополнительных вариантах осуществления, являющихся примерами, дозировка пептида YY находится в пределах приблизительно от 0,5 до 1,0 пикомолей на кг массы тела. В предпочтительном варианте осуществления интраназальная доза должна быть в диапазоне от 50 до 400 мкг, предпочтительно от 100 до 200 мкг, наиболее предпочтительно от 100 до 150 мкг. Фармацевтические препараты по данному изобретению можно вводить один или более раз в день (например, до приема пищи), или 3 раза в неделю, или один раз в неделю в течение срока от одной недели до по меньшей мере 96 недель или даже в течение жизни конкретного пациента или субъекта. В определенных вариантах осуществления фармацевтические препараты по этому изобретению вводят один или более раз в день,два раза в день, четыре раза в день, шесть раз в день или восемь раз в день. Используют агенты, способствующие интраназальной доставке, которые способствуют доставке пептида YY в или через поверхность слизистых оболочек носовой полости. Для пассивно абсорбируемых лекарственных средств относительный вклад параклеточного и трансклеточного пути в транспорт-6 008829 лекарственного средства зависит от рКа, коэффициента распределения, молекулярного радиуса и заряда лекарственного средства, рН среды просвета, в который доставляют лекарственное средство, и площади абсорбирующей поверхности. Агент, способствующий интраназальной доставке, по данному изобретению может быть агентом контроля рН. рН фармацевтического препарата по данному изобретению является фактором, влияющим на абсорбцию пептида YY параклеточным и трансклеточным путями транспорта лекарственного средства. В одном варианте осуществления фармацевтический препарат по данному изобретению имеет величину рН, установленную приблизительно между 3,0 и 6,5. В дополнительном варианте осуществления фармацевтический препарат по данному изобретению имеет величину рН, установленную приблизительно между 3,0 и 5,0. В дополнительном варианте осуществления фармацевтический препарат по данному изобретению имеет величину рН, установленную приблизительно между 4,0 и 5,0. Обычно величина рН составляет 5,00,3. Краткое описание рисунков Фиг. 1 показывает стабильность PYY3-36 при высокой температуре (40 С) при различных рН от 3,0 до 7,4. Фиг. 2 показывает данные по TEER (трансэпителиальное электрическое сопротивление) у агентов,способствующих проникновению. Фиг. 3 показывает жизнеспособности клеток с кандидатными препаратами PYY. Фиг. 4 показывает цитотоксические эффекты кандидатных препаратов. На фиг. 2-4:EN7 - н-каприновой кислоты натриевая соль (0,075% масса/объем);EN 14 - натрия гликохолат (1% масса/объем). Фиг. 5 показывает синергические вклады различных компонентов в проникающую способность лекарственного средства. На фиг. 5 EN1 представляет собой DDPC, EN2 представляет собой метилцикло декстрин и ЕХ 1 представляет собой EDTA. Фиг. 6 показывает уровни PYY3-36 в плазме крыс, квадраты представляют собой дозу 4,1 мкг/кг,треугольник представляет собой дозу 41 мкг/кг и кружки представляют собой дозу 205 мкг/кг. Фиг. 7 показывает дозовую линейность после интраназального введения PYY3-36 крысам, выраженную как зависимость Сmax-Cbas в пг/мл от дозы в мкг/кг. Фиг. 8 показывает дозовую линейность после интраназального введения PYY3-36 крысам в виде зависимости площади под кривой (AUC) от дозы в мкг/кг. Фиг. 9 показывает зависимость средней концентрации PYY в плазме от времени в минутах у трех человек-добровольцев, каждому из которых ввели 20 мкг PYY(3-36) через нос. Фиг. 10 показывает зависимость средней концентрации PYY в плазме от времени в минутах у трех добровольцев, каждому из которых ввели 50 мкг PYY(3-36) через нос. Фиг. 11 показывает зависимость средней концентрации PYY в плазме от времени в минутах у трех человек-добровольцев, каждому из которых ввели 100 мкг PYY(3-36) через нос. Фиг. 12 показывает зависимость средней концентрации PYY в плазме от времени в минутах у трех человек-добровольцев, каждому из которых ввели 150 мкг PYY3-36 через нос. Фиг. 13 показывает зависимость средней концентрации PYY в плазме от времени в минутах у трех человек-добровольцев, каждому из которых ввели 200 мкг PYY(3-36) через нос. Фиг. 14 показывает зависимость концентрации PYY в плазме в пикомолях/л от времени для пяти групп здоровых людей-добровольцев, которые получали через нос PYY(3-36). Дозы составляли 200, 150,100, 50 и 20 мкг PYY3-36. Фиг. 15 показывает дозовую линейность, выраженную как зависимость Сmax PYY в пг/мл от дозыPYY(3-36), введенной людям-добровольцам. Фиг. 16 показывает дозовую линейность в виде зависимости средней AUC для PYY в пг/мл от дозыPYY(3-36), введенной людям-добровольцам. Фиг. 17 показывает визуальную аналоговую шкалу (VAS) в зависимости от дозы PYY(3-36), введенной людям-добровольцам. Был задан вопрос: "Насколько вы голодны" Чем ниже балл, тем менее голодным был индивид по 100-балльной шкале.-7 008829 Фиг. 18 показывает визуальную аналоговую шкалу (VAS) в зависимости от дозы PYY(3-36), введенной людям-добровольцам. Был задан вопрос: "Сколько вы можете съесть" Чем ниже балл, тем менее голодным был индивид по 100-балльной шкале. Фиг. 19 показывает визуальную аналоговую шкалу (VAS) в зависимости от дозы PYY(3-36), введенной людям-добровольцам. Был задан вопрос: "Насколько сытым(ой) вы себя чувствуете" Чем ниже балл, тем менее сыт индивид по 100-балльной шкале. Фиг. 20 показывает в процентах проникающую способность PYY(3-36), содержащего эндотоксин,против проникающей способности PYY(3-36), свободного от эндотоксина. Подробное описание изобретения Как отмечено выше, данное изобретение предлагает улучшенные способы и композиции для доставки, осуществляемой через слизистые оболочки, пептида, связывающегося с Y2-рецепторами, субъектам, представляющим собой млекопитающее, для лечения или предотвращения множества разных заболеваний и состояний. Примеры надлежащих субъектов, представляющих собой млекопитающее, для лечения и профилактики в соответствии со способами по этому изобретению включают в себя, без ограничения, людей и приматов, не являющих людьми, виды домашнего скота, такие как лошади, крупный рогатый скот, овцы и козы, и экспериментальных и домашних животных, в том числе собак, кошек, мышей,крыс, морских свинок и кроликов. Для лучшего понимания данного изобретения даны нижеследующие определения. ПЕПТИДЫ, СВЯЗЫВАЮЩИЕСЯ С Y2-РЕЦЕПТОРОМ Пептиды, связывающиеся с Y2-рецептором, используемые в препаратах для доставки через слизистые оболочки по данному изобретению, включают в себя семейство панкреатических полипептидов. В данном контексте оно содержит три семейства встречающихся в природе биоактивных пептидов, РР,NPY и PYY. Примеры пептидов, связывающихся с Y2-рецепторами, и их применения раскрыты в патентах США 5026685; 5574010; 5604203; 5696093; 6046167; в Gehlert et.al., Proc Soc Exp Biol Med 218/722 (1998); в Sheikh et al. Am J Physiol, 267;701-15(1991); в Fournier et al., Mol Pharmacol 45:93-101 (1994); в Kirby et al., J Med Chem 38:4579-4586 (1995); в Rist et al., Eur J Biochem 247: 1019-1028 (1997); в Kirby etal., J Med Chem 36-3802-3808 (1993); в Grundemar et al., Regulatory Peptides 62: 131-136 (1996); в патентах США 5696093 (примеры PYY-агонистов), 6046167. В соответствии с данным изобретением пептид,связывающийся с Y2-рецепторами, включает в себя свободные основания, соли, представляющие собой соли присоединения кислоты или соли металла, такие как соли калия или натрия, или пептиды, представляющие собой пептиды, связывающиеся с Y2-рецепторами, которые были модифицированы такими способами, как амидирование, гликозилирование, ацилирование, сульфатирование, фосфорилирование,ацетилирование и циклизация (патенты США 6093692 и 6225445) и пэгилирование. АГОНИСТЫ ПЕПТИДА YY В данном контексте термин "PYY" относится к PYY(1-36) в формах, представляющих собой нативную последовательность или ее вариант, а также к производным, фрагментам и аналогам PYY из любого источника, будь то натуральные, синтетические или рекомбинантные. PYY должен состоять, по меньшей мере, из последних 15 аминокислотных остатков или их аналогов в последовательности PYY, PYY(2236) (SEQ ID NO: 3). Другими пептидами PYY, которые можно использовать, являются PYY(1-36) (SEQ(SEQ ID NO: 20) и PYY(21-36) (SEQ ID NO: 21). Эти пептиды в типичных случаях связываются с Yрецепторами в мозге и других местах, особенно с Y2- и/или Y5-рецепторами. В типичных случаях эти пептиды синтезируют в свободной от эндотоксина или пирогена форме, хотя это не всегда является необходимым. Другие пептиды PYY включают в себя пептиды PYY с консервативной аминокислотного остатка,например, сайт-специфической мутацией пептида PYY, в том числе [Asp15] PYY(15-36) (SEQ ID NO: 90),[Thr13] PYY(13-36) (SEQ ID NO: 91), [Val12] PYY(12-36)(SEQ ID NO: 92), [Glu11] PYY(11-36) (SEQ ID NO: 93), [Asp10] PYY(10-36) (SEQ ID NO: 94), [Val7] PYY(7-36) (SEQ ID NO: 95), [Asp6] PYY(6-36) (SEQ IDNO: 99), [Val3] PYY(3-36) (SEQ ID NO: 100) и [Leu3] PYY(3-36) (SEQ ID NO: 101). Другие пептиды PYY включают в себя пептиды с заменой по меньшей мере двух консервативных аминокислотных остатков, в том числе [Asp10, Asp15] PYY(10-36) (SEQ ID NO: 102), [Asp6, Thr13] PYY(6-36) (SEQ ID NO: 103), [Asn4,Asp15] PYY(4-36) (SEQ ID NO: 104) и [Leu3, Asp10] PYY(3-36) (SEQ ID NO: 105. Также сюда включены аналоги PYY, например те, что раскрыты в патентах США 5604203 и 5574010; в Balasubramaniam, etal., Peptide Research 1: 32 (1988); в заявке на Японский патент 2225497 (1990); в Balasubramaniam, et al.,Peptides 14:1011, 1993; в Grandt, et al., Reg. Peptides 51: 151, (1994); в Международной заявке РСТ 94/03380, в патентах США 5604203 и 5574010. Эти пептиды в типичных случаях связываются с Yрецепторами в мозге и других местах, особенно с Y2- и/или Y5-рецепторами. В типичных случаях эти-8 008829 пептиды синтезируют в свободных от эндотоксина или пирогена формах, хотя это не всегда является необходимым.PYY-агонисты включают в себя крысиный PYY (SEQ ID NO: 72) и усеченные по аминоконцу формы, соответствующие человеческому PYY, свиной PYY (SEQ ID NO: 73), и усеченные по аминоконцу формы, соответствующие человеческому PYY, и PYY морской свинки (SEQ ID NO: 74), и усеченные по аминоконцу формы, соответствующие человеческому PYY. В соответствии с данным изобретением пептид PYY также включает в себя свободные основания,соли присоединения кислоты или соли металла, такие как соли калия или натрия этих пептидов, и пептиды PYY, модифицированные такими способами, как амидирование, гликозилирование, ацилирование,сульфатирование, фосфорилирование, ацетилирование, циклизация и другими хорошо известньми способами ковалентной модификации. Эти пептиды в типичных случаях связываются с Y-рецепторами в мозге и других местах, особенно с Y2- и/или Y5-рецепторами. В типичных случаях эти пептиды синтезируют в свободных от эндотоксина или пирогена формах, хотя это не всегда является необходимым. АГОНИСТЫ НЕЙРОПЕПТИДА YNPY является еще одним пептидом, связывающимся с Y2-рецепторами. Пептиды NPY включают в себя полноразмерный NPY(1-36) (SEQ ID NO: 22), а также фрагменты NPY(1-36), которые были усечены по аминоконцу. Для эффективного связывания с Y2-рецептором NPY-агонист должен иметь, по меньшей мере, последние 11 аминокислотных остатков при карбоксиконце, то есть должен состоять из NPY(2636) (SEQ ID NO: 23). Другие примеры NPY-агонистов, которые связываются с Y2-рецептором, представляют собой NPY(3-36) (SEQ ID NO: 24), NPY(4-36) (SEQ ID NO: 25), NPY(5-36) (SEQ ID NO: 26), NPY(636) (SEQ ID NO: 27), NPY(7-36) (SEQ ID NO: 28), NPY(8-36) (SEQ ID NO: 29), NPY(9-36) (SEQ ID NO: 30), NPY(10-36) (SEQ ID NO: 31), NPY(11-36) (SEQ ID NO: 32), NPY(12-36) (SEQ ID NO: 33), NPY(13-36)(SEQ ID NO: 41), NPY(21-36) (SEQ ID NO: 42), NPY(22-36) (SEQ ID NO: 43), NPY(23-36) (SEQ ID NO: 44), NPY(24-36) (SEQ ID NO: 45) и NPY(25-36) (SEQ ID NO: 46). Другие агонисты NPY включают в себя крысиный NPY (SEQ ID NO: 75) и усеченные по аминоконцу формы от NPY(3-36) до NPY(26-36), как в человеческой форме, кроличий NPY (SEQ ID NO: 76) и усеченные по аминоконцу формы от NPY(3-36) до NPY(26-36), как в человеческой форме, собачий NPY(SEQ ID NO: 77) и усеченные по аминоконцу формы от NPY(3-36) до NPY(26-36), как в человеческой форме, свиной NPY (SEQ ID NO: 78) и усеченные по аминоконцу формы от NPY(3-36) до NPY(26-36),как в человеческой форме, коровий NPY (SEQ ID NO: 79) и усеченные по аминоконцу формы от NPY(336) до NPY26-36, как в человеческой форме, овечий NPY (SEQ ID NO: 80) и усеченные по аминоконцу формы от NPY(3-36) до NPY(26-36), как в человеческой форме, и NPY морской свинки (SEQ 81) и усеченные по аминоконцу формы от NPY(3-36) до NPY(26-36), как в человеческой форме. В соответствии с данным изобретением, пептид NPY также включает в себя свободные основания,соли присоединения кислоты или соли металла, такие как соли калия или натрия, этих пептидов и пептиды NPY, которые модифицированы такими способами, как амидирование, гликозилирование, ацилирование, сульфатирование, фосфорилирование, ацетилирование, циклизация и другими известными способами ковалентной модификации. Эти пептиды в типичных случаях связываются с Y-рецепторами в мозге и других местах, особенно с Y2- и/или Y5-рецепторами. В типичных случаях синтезируют эти пептиды в свободных от эндотоксина или пирогена формах, хотя это не всегда является необходимым. Панкреатический пептид Панкреатический пептид (РР) и РР-агонист также связываются с Y2-рецептором. Примеры РРагонистов представляют собой полноразмерный РР(1-36) (SEQ ID NO: 47) и множество фрагментов РР,усеченных по аминоконцу. Для связывания с Y2-рецепторами РР-агонист должен иметь последние 11 аминокислотных остатков при карбоксиконце, РР(26-36), (SEQ ID NO: 48). Примеры других РР, которые связываются с Y2-рецепторами, представляют собой РР(3-36) (SEQ ID NO: 49), РР(4-36) (SEQ ID NO: 50), PP(5-36) (SEQ ID NO: 51), РР(6-36) (SEQ ID NO: 52), PP(7-36) (SEQ ID NO: 53), PP(8-36) (SEQ ID(SEQ ID NO: 69), PP(24-36) (SEQ ID NO: 70) и РР(25-36) (SEQ ID NO: 71). Другие РР-агонисты включают в себя овечий РР (SEQ ID NO: 82) и усеченные по аминоконцу формы от РР(3-36) до РР(26-36), как в человеческой форме, свиной РР (SEQ ID NO: 83) и усеченные по аминоконцу формы от РР(3-36) до РР(26-36), как в человеческой форме, собачий РР (SEQ ID NO: 84) и усеченные по аминоконцу формы от РР(3-36) до РР(26-36), как в человеческой форме, кошачий РР (SEQ IDNO: 85) и усеченные по аминоконцу формы от РР(3-36) до РР(26-36), как в человеческой форме, коровий РР (SEQ ID NO: 86) и усеченные по аминоконцу формы от РР(3-36) до РР(26-36), как в человеческой форме, крысиный РР (SEQ ID NO:87) и усеченные по аминоконцу формы от РР(3-36) до РР(26-36), как в-9 008829 человеческой форме, мышиный (SEQ 88) и усеченные по аминоконцу формы от РР(3-36) до РР(26-36),как в человеческой форме, и РР морской свинки (SEQ ID NO: 89). В соответствии с данным изобретением пептид РР также включает в себя свободные основания, соли присоединения кислоты или соли металла, такие как соли калия или натрия, этих пептидов, и пептиды РР, которые модифицированы такими способами, как амидирование, гликозилирование, ацилирование,сульфатирование, фосфорилирование, ацетилирование, циклизация, и другими известными способами ковалентной модификации. Эти пептиды в типичных случаях связываются с Y-рецепторами в мозге и других местах, особенно с Y2- и/или Y5-рецепторами. В типичных случаях эти пептиды синтезируют в свободных от эндотоксина или пирогена формах, хотя это не всегда является необходимым. Агенты, способствующие доставке через слизистые оболочки"Агенты, способствующие доставке через слизистые оболочки", определяют как химические и другие наполнители, которые при добавлении к препарату, содержащему воду, соли и/или обычные буферы и пептиды, связывающиеся с Y2-рецепторами (контрольный препарат), дают препарат, который дает значительное увеличение транспорта пептида, связывающегося с Y2-рецепторами, через слизистую мембрану при измерении максимальной концентрации (Сmax) в крови, сыворотке или цереброспинальной жидкости или по площади под кривой, AUC, на графике зависимости концентрации от времени. Слизистая оболочка включает в себя поверхность слизистых носовой полости, ротовой полости, кишки, щеки,бронхов и легких, влагалища и прямой кишки и фактически включает в себя все мембраны, секретирующие слизь, которые выстилают полости или проходы тела и сообщаются с внешней средой. Агенты, способствующие доставке, через слизистые, иногда называют носителями. Свободный от эндотоксина препарат Термин "свободный от эндотоксина препарат" означает препарат, который содержит пептид, связывающийся с Y2-рецепторами, и один или более агентов, способствующих доставке через слизистые оболочки, который, по существу, свободен от эндотоксинов и/или связанных с ними пирогенных веществ. Эндотоксины включают в себя токсины, которые заключены внутри микроорганизма и высвобождаются только когда микроорганизмы разрушены или мертвы. Пирогенные вещества включают в себя индуцирующие лихорадку термостабильные вещества (гликобелки) из наружной мембраны бактерий и других микроорганизмов. Оба этих вещества могут вызывать лихорадку, гипотонию и шок при введении людям. Получение препаратов, свободных от эндотоксина, может требовать специального оборудования и специалистов и может быть значительно более дорогостоящим, чем изготовление препаратов, которые не являются свободными от эндотоксина. Так как было показано, что внутривенное введение NPY или PYY одновременно с инфузией эндотоксина грызунам предотвращает гипотонию и даже смерть, ассоциированные с введением эндотоксина в отдельности (патент США 4839343), получение препаратов этих терапевтических агентов, свободных от эндотоксина, не считается необходимым для не парентерального"Неинфузионное введение" означает любой способ доставки, который не включает в себя инъекцию прямо в артерию или вену, способ, при котором принуждается или направляется (в типичных случаях жидкость) во что-то и особенно в часть тела вводится иглу, шприц или другое инвазивное средство. Неинфузионное введение включает в себя подкожную инъекцию, внутримышечную инъекцию, внутрибрюшинную инъекцию и неинъекционные способы доставки на слизистую оболочку. Лечение и предотвращение ожирения Как отмечено выше, это изобретение предлагает улучшенные и полезные способы и композиции для доставки, осуществляемой через слизистые оболочки носовой полости, пептида, связывающегося сY2-рецепторами, для предотвращения и лечения ожирения у субъектов, представляющих собой млекопитающее. В данном контексте предотвращение и лечение ожирения означают предотвращение начала или снижение частоты и тяжести клинического ожирения путем снижения потребления пищи во время еды и/или снижения массы тела во время введения или поддержания сниженной массы тела после потери массы или до прибавления массы. Это изобретение предлагает улучшенные и полезные способы и композиции для доставки, осуществляемой через слизистые оболочки носовой полости, пептида, связывающегося с Y2-рецепторами, в области мозга, например гипоталамус или проопиомеланокортиновые (РОМС) и NPY-нейроны аркуатного ядра, для предотвращения и лечения ожирения у субъектов, представляющих собой млекопитающее. Пептид, связывающийся с Y2-рецепторами, можно также вводить в сочетании с антагонистом Y1 рецептора, таким как дигидропиридин. Способы и композиции доставки Улучшенные способы и композиции для введения, осуществляемого через слизистые оболочки,пептида, связывающегося с Y2-рецепторами, субъектам, представляющим собой млекопитающее, оптимизируют режимы дозировки пептида, связывающегося с Y2-рецепторами. Данное изобретение предлагает доставку, осуществляемую через слизистые оболочки, пептида, связывающегося с Y2-рецепторами,введенного в один состав с одним или более агентами, способствующими доставке через слизистые оболочки, причем высвобождение дозы пептида, связывающегося с Y2-рецепторами, является существенно- 10008829 нормализованным и/или постоянным для периода эффективной доставки пептида, связывающегося с Y2 рецепторами, в диапазонах от 0,1 до 2,0; от 0,4 до 1,5; от 0,7 до 1,5 или от 0,8 до 1,0 ч после введения через слизистые оболочки. Достигнутому постоянному высвобождению пептида, связывающегося с Y2 рецепторами, можно способствовать повторным введением экзогенного пептида, связывающегося с Y2 рецепторами, при использовании способов и композиций по данному изобретению. Композиции и способы постоянного высвобождения Улучшенные композиции и способы для введения, осуществляемого через слизистые оболочки,пептида, связывающегося с Y2-рецепторами, субъектам, представляющим собой млекопитающее, оптимизируют режимы дозировки пептида, связывающегося сY2-рецепторами. Данное изобретение предлагает улучшенную доставку, осуществляемую через слизистые оболочки (например, носовые), препарата,содержащего пептид, связывающийся с Y2-рецепторами, в комбинации с одним или более агентами, способствующими доставке через слизистые оболочки, и возможно агентом или агентами, способствующими постоянному высвобождению. Агенты, способствующие доставке через слизистые оболочки, по данному изобретению дают эффективное увеличение доставки, например, увеличение максимальной концентрации в плазме (Сmax) для способствования терапевтической активности пептида, связывающегося сY2-рецепторами, вводимого через слизистые оболочки. Вторым фактором, который влияет на терапевтическую активность пептида, связывающегося с Y2-рецепторами, в плазме крови и в ЦНС, является время удержания (ВY). Агенты, способствующие постоянному высвобождению, в комбинации с агентами, способствующими интраназальной доставке, увеличивают Сmax и увеличивают время удержания (ВY) пептида, связывающегося с Y2-рецепторами. В настоящем изобретении раскрыты полимерные средства доставки и другие агенты и способы по данному изобретению, которые используются в препаратах, способствующих постоянному высвобождению, например полиэтиленгликоль (ПЭГ). Данное изобретение предлагает улучшенный способ доставки и лекарственную форму пептида, связывающегося с Y2 рецепторами, для лечения симптомов, относящихся к ожирению, раку толстой кишки, панкреатическому раку или раку груди у субъектов, представляющих собой млекопитающее. В препаратах и способах по этому изобретению для доставки, осуществляемой через слизистые оболочки, пептид, связывающийся с Y2-рецепторами, часто комбинируют или согласованно вводят с подходящим носителем или с носителем для доставки через слизистые оболочки. В данном контексте термин "носитель" означает фармацевтически приемлемый твердый или жидкий наполнитель, разбавитель или инкапсулирующий материал. Водосодержащий жидкий носитель может содержать фармацевтически приемлемые добавки, такие как подкисляющие агенты, подщелачивающие агенты, противомикробные консерванты, антиоксиданты, забуферивающие агенты, хелатирующие агенты, комплексообразующие агенты, солюбилизирующие агенты, увлажнители, растворители, суспендирующие и/или увеличивающие вязкость агенты, агенты тоничности, смачивающие агенты или другие биосовместимые материалы. Табуляцию ингредиентов, перечисленных по вышеуказанным категориям, можно найти вU.S. Pharmacopeia National Formulary, 1857-1859, (1990). Некоторыми примерами материалов, которые могут служить как фармацевтически приемлемые носители, являются сахара, такие как лактоза, глюкоза и сахароза; крахмалы, такие как кукурузный крахмал и картофельный крахмал; целлюлоза и ее производные, такие как натрий карбоксиметилцеллюлоза, этилцеллюлоза и ацетат целлюлозы; порошковый трагакант; солод; желатин; тальк; наполнители, такие как шоколадное масло и воски для суппозиториев; масла, такие как арахисовое масло, хлопковое масло, подсолнечное масло, кунжутное масло, оливковое масло, кукурузное масло и соевое масло; гликоли, такие как пропиленгликоль; полиолы, такие как глицерин, сорбит, маннит и полиэтиленгликоль; сложные эфиры, такие как этилолеат и этиллаурат; агар; забуферивающие агенты, такие как гидроксид магния и гидроксид алюминия; альгиновая кислота; апирогенная вода; изотонический физраствор; раствор Рингера, растворы этилового спирта и фосфатного буфера, а также другие нетоксичные совместимые вещества, применяемые в фармацевтических препаратах. Смачивающие агенты, эмульгаторы и смазки, такие как лаурилсульфат натрия и стеарат магния, а также красители, агенты высвобождения, агенты нанесения оболочки, подслащающие, вкусовые и ароматизирующие агенты, консерванты и антиоксиданты также могут присутствовать в композиции в соответствии с пожеланиями составителя. Примеры фармацевтически приемлемых антиоксидантов включают в себя водорастворимые антиоксиданты, такие как аскорбиновая кислота, цистеина гипрохлорид, натрия бисульфит, натрия метабисульфит, натрия сульфит и тому подобные; жирорастворимые антиоксиданты, такие как аскорбилпальмитат, бутилированный гидроксианизол (ВНА), бутилированный гидрокситолуол (ВНТ), лецитин, пропилгаллат, альфа-токоферол и тому подобные; и металл-хелатирующие агенты, такие как лимонная кислота, этилендиаминтетрауксусная кислота (ЭДТА), сорбит, винная кислота, фосфорная кислота и тому подобные. Количество активного ингредиента, которое можно комбинировать с материалами-носителями для получения стандартной лекарственной формы, должно варьировать в зависимости от конкретного способа введения. В композициях и способах по этому изобретению для доставки через слизистые оболочки используют различные агенты, способствующие доставке, которые способствуют доставке пептида, связывающегося с Y2-рецепторами, в или через слизистую поверхность. В этом отношении доставка пептида, связывающегося с Y2-рецепторами, через слизистый эпителий может происходить "трансклеточным" или"параклеточным" образом. Степень, до которой эти пути вносят вклад в суммарный поток и биологическую доступность пептида, связывающегося с Y2-рецепторами, зависит от среды слизистой мембраны,физико-химических свойств активного агента и свойств слизистого эпителия. Параклеточный транспорт включает в себя только пассивную диффузию, в то время как трансклеточный транспорт может происходить пассивным, усиленным или активным способами. Обычно, гидрофильные, пассивно транспортируемые полярные растворенные вещества диффундируют параклеточным путем, в то время как более липофильные растворенные вещества используют трансклеточный путь. Абсорбцию и биологическую доступность (например, отраженную коэффициентом проницаемости или физиологическим анализом) для разнообразных пассивно и активно абсорбируемых растворенных веществ можно легко оценить в терминах компонентов как параклеточной, так и трансклеточной доставки для любого выбранного пептида,связывающегося с Y2-рецепторами, по этому изобретению. Для пассивно абсорбируемых лекарственных средств относительный вклад параклеточного и трансклеточного путей в транспорт лекарственного средства зависит от рКа, коэффициента распределения, молекулярного радиуса и заряда лекарственного средства, рН среды просвета, в который доставляют лекарственное средство, и площади абсорбирующей поверхности. Параклеточный путь представляет собой относительно малую долю доступной поверхности в области эпителия слизистых оболочек носовой полости. В общих словах, сообщалось, что клеточные мембраны занимают область поверхности слизистых, которая является в тысячу раз большей, чем область, занятая параклеточными промежутками. Таким образом, учитывая меньшую доступную области дискриминацию против проникновения макромолекул на основании их размера и заряда, можно предположить, что для транспорта лекарственного средства параклеточный путь обычно должен быть менее предпочтительным путем, чем трансклеточная доставка. Удивительно, что способы и композиции по этому изобретению обеспечивают значительно усиленный транспорт биотерапевтических средств в и через слизистые эпителии параклеточным путем. Поэтому способы и композиции по этому изобретению успешно нацелены как на параклеточные, так и на трансклеточные пути, альтернативным образом или в пределах одного способа или композиции. В данном контексте "агенты, способствующие доставке через слизистые оболочки" включают в себя агенты, которые улучшают высвобождение или растворимость (например, из средства доставки препарата), скорость диффузии, проникающую способность и сроки поглощения, время удержания, стабильность, эффективный период полужизни, уровни пиковой или постоянной концентрации, клиренс и другие желаемые характеристики доставки через слизистые оболочки (например, при измерении в месте доставки или в выбранном целевом месте активности, таком как кровеносная или центральная нервная система) пептида, связывающегося с Y2-рецепторами, или другого(их) биологически активного(их) соединения(й). Улучшение доставки через слизистые может, таким образом, происходить через любое множество разных механизмов, например увеличением диффузии, транспорта, сохранности или стабильности пептида, связывающегося с Y2-рецепторами, увеличением текучести мембраны, модулированием доступности или действия кальция и других ионов, которые регулируют внутриклеточную или параклеточную проникающую способность, солюбилизацией компонентов слизистых оболочек (например, липидов), изменением уровней небелковых и белковых сульфгидрилов в слизистых тканях, увеличением тока воды через слизистые поверхности, модулированием физиологии эпителиальных стыков, снижением вязкости слизи, покрывающей слизистый эпителий, снижением скорости выведения слизи ресничками и другими механизмами. В данном контексте "количество пептида, связывающегося с Y2-рецепторами, эффективное через слизистые оболочки" подразумевает эффективную доставку, осуществляемую через слизистые оболочки пептида, связывающегося с Y2-рецепторами, в целевое место для активности лекарственного средства в субъекте, причем эта доставка может вовлекать множество путей доставки или переноса. Например, данный активный агент может пройти через просветы между клетками слизистой оболочки и достичь прилегающей сосудистой стенки, в то время как другим путем этот агент может либо пассивно, либо активно быть захваченным клетками слизистых для действия в пределах этих клеток или для высвобождения или транспортировки из клеток с достижением вторичного целевого места, такого как системное кровообращение. Способы и композиции по этому изобретению могут способствовать транслокации активных агентов по одному или нескольким из таких альтернативных путей или могут действовать прямо на слизистую ткань или проксимальную сосудистую ткань, чтобы способствовать абсорбции или проникновению активного агента(ов). Способствование абсорбции или проникновению в этом контексте не ограничено этими механизмами. В данном контексте термин "пиковая концентрация (Сmax) пептида, связывающегося с Y2 рецепторами, в плазме крови", "область под кривой зависимости концентрации в плазме крови от времени (AUC) для пептида, связывающегося с Y2-рецепторами", "время до достижения максимальной концентрация (tmax) пептида, связывающегося с Y2-рецепторами, в плазме крови" представляют собой фармакокинетические параметры, известные специалисту. Laursen et al., Eur. J. Endocrinology, 135: 309315,1996. "Кривая зависимости концентрации от времени" определяет концентрацию пептида, связывающегося с Y2-рецепторами, в сыворотке крови субъекта в зависимости от времени после введения дозы пептида, связывающегося с Y2-рецепторами, субъекту через нос, внутримышечным, подкожньм или- 12008829 другим парентеральным путем введения. "Сmax" представляет собой максимальную концентрацию пептида, связывающегося с Y2-рецепторами, в сыворотке крови субъекта после введения одной дозы пептида, связывающегося с Y2-рецепторами, субъекту, "tmax" представляет собой время для достижения максимальной концентрации пептида, связывающегося с Y2-рецепторами, в сыворотке крови субъекта после введения одной дозы пептида, связывающегося с Y2-рецепторами, субъекту. В данном контексте термин "площадь под кривой зависимости концентрации в плазме крови от времени (AUC) для пептида, связывающегося с Y2-рецепторами" рассчитывают в соответствии с линейным правилом трапеций и с добавлением остаточных площадей. Уменьшение на 23% или увеличение на 30% между двумя дозами будет выявлено с вероятностью 90% (ошибка типа II, =10%). "Скорость доставки" или "скорость абсорбции" оценивают сравнением времени (tmax) достижения максимальной концентрации (Сmax). Как Сmax, так и tmax анализируют при использовании непараметрических методов. Сравнение фармакокинетики внутримышечного, подкожного, внутривенного и интраназального введений пептида, связывающегося с Y2-рецепторами, осуществляют вариационным анализом (ANOVA). При парном сравнении для оценки достоверности используют последовательную процедуру БонферрониХолмса. Соотношение доза-ответ у трех интраназальных доз оценивают регрессионным анализом. Р 0,05 считают достоверным. Результаты представлены как средние значения +/- среднеквадратичная ошибка (SEM). В то время как механизм способствования абсорбции может варьировать с разными агентами, способствующими доставке через слизистые, по этому изобретению полезные реагенты в этом контексте не должны существенно нежелательным образом влиять на слизистую ткань и должны быть выбраны в соответствии с физико-химическими характеристиками конкретного пептида, связывающегося с Y2 рецепторами, или другого активного или способствующего доставке агента. В этом контексте агенты,способствующие доставке, которые увеличивают проникновение или увеличивают проницаемость слизистой ткани, часто приводят к некоторому изменению защитного барьера слизистой оболочки. Для того,чтобы такие агенты, способствующие доставке, имели ценность по этому изобретению, обычно желательно, чтобы любые значительные изменения в проницаемости слизистой оболочки являлись обратимыми в пределах временных рамок, подходящих для желаемой длительности доставки лекарственного средства. Более того, не должно быть существенной кумулятивной токсичности и любых перманентных пагубных изменений, индуцированных в барьерных свойствах слизистой оболочки при длительном применении. В пределах определенных аспектов этого изобретения способствующие абсорбции агенты для согласованного введения или комбинационного препарата с пептидом, связывающимся с Y2-рецепторами,по этому изобретению выбирают из малых гидрофильных молекул, включающих в себя, без ограничения, диметилсульфоксид (ДМСО), диметилформамид, этанол, пропиленгликоль и 2-пирролидоны. Или же для усиления доставки, осуществляемой через слизистые оболочки, пептида, связывающегося с Y2 рецепторами, можно использовать длинноцепочечные амфипатические молекулы, например децилметилсульфоксид, азон, лаурилсульфат натрия, олеиновую кислоту и соли желчных кислот. В дополнительных аспектах поверхностно-активные агенты (например, полисорбаты) используют как вспомогательные соединения, агенты процессинга или добавки в препарат для способствования интраназальной доставке пептида, связывающегося с Y2-рецепторами. Такие агенты, как ДМСО, полиэтиленгликоль и этанол, могут, если присутствуют в достаточно высоких концентрациях в среде доставки (например, при предварительном введении или включении в терапевтический препарат), поступать в водную фазу слизистой оболочки и изменять ее растворяющие свойства, тем самым способствуя распределению пептида,связывающегося с Y2-рецепторами, из носителя в слизистую оболочку. Дополнительные агенты, способствующие доставке через слизистые оболочки, которые являются полезными в согласованном введении и в способах процессинга и в комбинационных препаратах по этому изобретению, включают в себя, без ограничения, смешанные мицеллы; енамины; доноры оксида азота(например, S-нитрозо-N-ацетил-DL-пеницилламин, NOR1, NOR4), которые предпочтительно вводят совместно с перехватчиком NO, таким как карбокси-PITO или доклофенак натрий; салицилат натрия; глицериновые эфиры ацетоуксусной кислоты (например, глицерил-1,3-диацетоацетат или 1,2 изопропилиденглицерин-3-ацетоацетат); и другие агенты, способствующие высвобождению-диффузии или интра- или транс-эпителиальному проникновению, которые являются физиологически совместимыми для доставки через слизистые оболочки. Другие способствующие абсорбции агенты выбирают из множества разных носителей, основ и наполнителей, способствующих доставке через слизистые оболочки, стабильности, активности или транс-эпителиальному проникновению пептида, связывающегося с Y2 рецепторами. Они включают в себя, среди прочего, циклодекстрины и производные -циклодекстрина(например, 2-гидроксипропилциклодекстрин) и гептакис (2,6-ди-O-метилциклодекстрин). Эти соединения, возможно конъюгированные с одним или более активными ингредиентами и возможно входящие в состав маслянистой основы, способствуют биологической доступности в препаратах для слизистых по этому изобретению. Другие дополнительные способствующие абсорбции агенты, адаптированные для доставки через слизистые, включают в себя среднецепочечные жирные кислоты, включая моно- 13008829 и диглицериды (например, капрат натрия, экстракты коксового масла, Capmul) и триглицериды (например, амилодекстрин, Estaram 299, Miglyol 810). Доставляемые через слизистые оболочки терапевтические и профилактические композиции по данному изобретению можно обогащать любым подходящим способствующим проникновению агентом,который облегчает абсорбцию, диффузию или проникновение пептида, связывающегося с Y2 рецепторами, через слизистые барьеры. Промотором проникновения может быть любой фармацевтически приемлемый промотор. Таким образом, в более детальных аспектах этого изобретения предложены композиции, которые включают один или более способствующих проникновению агентов, выбираемых из производных салицилата натрия и салициловой кислоты (ацетилсалицилат, холинсалицилат, салициламид, и т.д.); аминокислот и их солей (например, моноаминокарбоновых кислот, таких как глицин, аланин, фенилаланин, пролин, гидроксипролин и т.д.; гидроксиаминокислот, таких как серин; кислых аминокислот, таких как аспарагиновая кислота, глутаминовая кислота, и т.д.; и основных аминокислот, таких как лизин и т.д., включая их соли со щелочным металлом или щелочно-земельньм металлом); и Nацетиламинокислот (N-ацетилаланин, N-ацетилфенилаланин, N-ацетилсерин, N-ацетилглицин, Nацетиллизин, N-ацетилглутаминовая кислота, N-ацетилпролин, N-ацетилгидроксипролин, и т.д.) и их солей (соли щелочного металла и соли щелочно-земельного металла). Также в качестве способствующих проникновению агентов в способах и композициях по этому изобретению предложены вещества, обычно используемые в качестве эмульгаторов (например, натрия олеилфосфат, натрия лаурилфосфат, натрия лаурилсульфат, натрия миристилсульфат, полиоксиэтиленалкильные эфиры и т.д.), капроевая кислота,молочная кислота, яблочная кислота и лимонная кислота и их соли со щелочным металлом, пирролидонкарбоновые кислоты, сложные эфиры алкилпирролидонкарбоновой кислоты, N-алкилпирролидоны,ацильные эфиры пролина и тому подобные. В различных аспектах этого изобретения предложены препараты и способы улучшенной доставки через слизистые оболочки носовой полости, которые делают возможной доставку пептида, связывающегося с Y2-рецепторами, и других терапевтических агентов по этому изобретению через слизистые барьеры между местами введения и выбранными целевыми местами. Определенные препараты являются специфическим образом адаптированными для выбранной целевой клетки, ткани или органа или даже конкретного заболевания. В других аспектах препараты и способы обеспечивают эффективный, селективный эндо- или трансцитоз пептида, связывающегося с Y2-рецепторами, специфически направленный по определенному внутриклеточному или межклеточному пути. В типичных случаях пептид, связывающийся с Y2-рецепторами, эффективно вносят при эффективных уровнях концентрации в носитель или другое средство доставки и доставляют и поддерживают в стабилизированной форме, например, у слизистой оболочки носовой полости и/или во время прохода через внутриклеточные компартменты и мембраны к отдаленным целевым местам действия лекарственного средства (например, кровоток или определенная ткань, орган или внеклеточный компартмент). Пептид, связывающийся с Y2-рецепторами,можно предоставлять в средстве доставки или модифицированным иным образом (например, в пролекарственной форме), причем высвобождение или активация пептида, связывающегося с Y2-рецепторами,запускается физиологическим стимулом (например, изменением рН, лизосомальными ферментами и т.д.) Часто пептид, связывающийся с Y2-рецепторами, является фармакологически неактивным, пока не достигает целевого для его активности места. В большинстве случаев, пептид, связывающийся с Y2 рецепторами, и другие компоненты препарата являются нетоксичными и неиммуногенными. В этом контексте, носители и другие компоненты препарата обычно выбирают по их способности быть быстро разлагаемыми и выводимыми в физиологических условиях. В то же время, эти препараты в лекарственной форме являются химически и физически стабильными для эффективного хранения. Аналоги и миметики пептидов и белков Для применения по этому изобретению в пределы определения биологически активных пептидов и белков включены натуральные или синтетические терапевтически или профилактически активные пептиды (состоящие из двух или более ковалентно связанных аминокислот), белки, фрагменты пептида или белка, аналоги пептида или белка и химически модифицированные производные или соли активных пептидов или белков. Для применения по этому изобретению подразумевается широкое множество разных полезных аналогов и миметиков пептида, связывающегося с Y2-рецепторами, которые можно получать и тестировать на биологическую активность в соответствии с известными способами. Часто пептиды или белки пептида, связывающегося с Y2-рецепторами, или другие биологически активные пептиды или белки для применения по этому изобретению представляют собой мутеины, которые легко получать частичной заменой, добавлением или делецией аминокислот в пределах встречающейся в природе или нативной (например, соответствующей дикому типу, встречающемуся в природе мутанту или аллельному варианту) пептидной или белковой последовательности. Дополнительно включены биологически активные фрагменты нативных пептидов или белков. Такие мутантные производные и фрагменты по существу сохраняют желаемую биологическую активность нативного пептида или белка. В случае пептидов или белков, имеющих углеводные цепи, биологически активные варианты, характеризующиеся изменениями в этих углеводных группировках, также являются включенными в пределы этого изобретения.- 14008829 В данном контексте термин "консервативная аминокислотная замена" относится к общей взаимозаменяемости аминокислотных остатков, имеющих похожие боковые цепи. Например, группой обычно взаимозаменяемых аминокислот, имеющих алифатические боковые цепи, являются аланин, валин, лейцин, и изолейцин; группой аминокислот, имеющих алифатические боковые цепи с гидроксилом, являются серии и треонин; группой аминокислот, имеющих амидсодержащие боковые цепи, являются аспарагин и глутамин; группой аминокислот, имеющих ароматические боковые цепи, являются фенилаланин,тирозин и триптофан; группой аминокислот, имеющих основные боковые цепи, являются лизин, аргинин и гистидин; и группой аминокислот, имеющий серосодержащие боковые цепи, является цистеин и метионин. Примеры консервативных замен включают в себя замену неполярного (гидрофобного) остатка,такого как изолейцин, валин, лейцин или метионин, на другой. Аналогичным образом, данное изобретение подразумевает замену полярного (гидрофильного) остатка, такую как аргинина на лизин, глутамина на аспарагин и треонина на серин. Дополнительно также подразумеваются замена основного остатка,такого как лизин, аргинин или гистидин, на другой или замена кислотного остатка, такого как аспарагиновая кислота или глутаминовая кислота, на другой. Примерами групп консервативной аминокислотной замены являются: валин-лейцин-изолейцин, фенилаланин-тирозин, лизин-аргинин, аланин-валин и аспарагин-глутамин. Выравниванием аналога пептида или белка с оптимально соответствующим нативным пептидом или белком и при использовании надлежащих анализов, например анализов адгезии белка или связывания с рецептором для определения выбранной биологической активности, можно легко идентифицировать работоспособные аналоги пептида и белка для применения в пределах способов и композиций по этому изобретению. Работоспособные аналоги пептида и белка в типичных случаях специфически иммунореактивны с антителами против соответствующего нативного пептида или белка. Подходом к стабилизации твердых белковых препаратов по этому изобретению является увеличение физической стабильности очищенного, например лиофилизированного, белка. Это должно ингибировать агрегацию из-за гидрофобных взаимодействий, а также по ковалентным путям, которые могут усиливаться при развертывании белка. Стабилизирующие препараты в этом контексте часто включают в себя препараты на основе полимера, например препарат(система доставки), представляющий(ая) собой биоразлагаемый гидрогель. Как отмечено выше, критическая роль воды в структуре, функции и стабильности белка является хорошо известной. В типичных случаях белки являются относительно стабильными в твердом состоянии при удалении большей части воды. Однако твердые терапевтические белковые препараты могут становиться гидратированными при хранении в условиях повышенной влажности или во время доставки из композиции или устройства для постоянного высвобождения. Стабильность белков обычно падает с увеличением гидратации. Вода может также играть значительную роль в агрегации твердого белка, например, увеличивая гибкость белка, приводящую к усилению доступности активных групп, предоставляя подвижную фазу для взаимодействующих групп и выступая как участник нескольких разрушительных процессов, таких как бета-элиминация и гидролиз. Белковые препараты, содержащие приблизительно от 6 до 28% воды, являются наиболее нестабильными. Ниже этого уровня подвижность связанной воды и внутренние движения белка являются низкими. Выше этого уровня подвижность воды и движения белка приближаются к таковым при полной гидратации. Вплоть до некоторой точки в нескольких системах наблюдали увеличение подверженности агрегации в твердой фазе при увеличении гидратации. Однако при более высоком содержании воды наблюдают, из-за эффекта разведения, меньшую агрегацию. В соответствии с этими принципами эффективным способом стабилизации пептидов и белков против агрегации в твердом состоянии для доставки через слизистые оболочки является контроль содержания воды в твердом препарате и поддержание активности воды в препарате на оптимальных уровнях. Этот уровень зависит от природы белка, но, в общем, белки, поддерживаемые ниже их покрытия "монослоем" воды, должны проявлять наибольшую стабильность в твердом состоянии. По этому изобретению предложено множество разных добавок, разбавителей, основ и средств доставки, которые эффективно контролируют содержание воды для способствования стабильности белка. Эти реагенты и материалы, представляющие собой носители, эффективные в качестве антиагрегационных агентов, в этом смысле включают в себя, например, полимеры различных функциональных группировок, такие как полиэтиленгликоль, декстран, диэтиламиноэтилдекстран и карбоксиметилцеллюлозу,которые значительно увеличивают стабильность и снижают агрегацию в твердой фазе у пептидов и белков, которые смешаны или связаны с ними. В некоторых случаях активности или физической стабильности белков можно способствовать различными добавками к водным растворам пептидного или белкового лекарственного средства. Например, можно использовать такие добавки, как полиолы (в том числе сахара), аминокислоты, белки, такие как коллаген и желатин, и различные соли. Определенные добавки, в частности сахара и другие полиолы, также придают значительную физическую стабильность сухим, например лиофилизированным, белкам. Эти добавки также можно использовать по этому изобретению для защиты белков от агрегации не только во время лиофилизации, но также во время хранения в сухом состоянии. Например, сахароза и Фиколл 70 (полимер, имеющий сахарозные блоки) проявляет значительную защиту против агрегации пептидов или белков во время инкубации- 15008829 в твердой фазе в различных условиях. Эти добавки могут также усиливать стабильность твердых белков,внедренных в полимерные матрицы. Другие дополнительные добавки, например сахароза, стабилизируют белки против агрегации в твердом состоянии во влажных атмосферах при повышенных температурах, как может происходить в определенных препаратах для постоянного высвобождения по этому изобретению. Белки, такие как желатин и коллаген, также служат как стабилизирующие или наполняющие агенты для снижения денатурации и агрегации нестабильных белков в этом контексте. Эти добавки можно включать в процесс расплава полимера и в композиции по этому изобретению. Например, полипептидные микрочастицы можно получать простой лиофилизаций или распылительной сушкой раствора, содержащего различные стабилизирующие добавки, описанные выше. Тем самым можно получать постоянное высвобождение неагрегированных пептидов и белков на протяжении длительного периода времени. Здесь предложены различные дополнительные препаративные компоненты и способы, а также специфичные добавки, которые обеспечивают препараты для доставки, осуществляемой через слизистые оболочки, пептидов и белков, склонных к агрегации, причем пептид или белок является стабилизированным, по существу, в чистой, неагрегированной форме при использовании солюбилизирующего агента. Для применения в этих способах и препаратах подразумевается ряд компонентов и добавок. Примерами этих солюбилизирующих агентов являются связанные димеры циклодекстринов (ЦД), которые селективно связываются с гидрофобными боковыми цепями полипептидов. Было обнаружено, что эти димеры ЦД связываются с гидрофобными участками белков, таким образом, который значительно ингибирует агрегацию. Это ингибирование является селективным по отношению как к димерам ЦД, так и к вовлеченному белку. Такое селективное ингибирование агрегации белка обеспечивает дополнительные преимущества в способах и композициях для интраназальной доставки по этому изобретению. Дополнительные агенты для применения в этом контексте включают в себя тримеры и тетрамеры ЦД с варьирующими геометриями, контролируемыми линкерами, которые специфически блокируют агрегацию пептидов и белков. Дополнительные солюбилизирующие агенты и способы для включения в это изобретение включают в себя применение пептидов и пептидомиметиков для селективного блокирования белок-белковых взаимодействий. В одном аспекте специфическое связывание гидрофобных боковых цепей, известное для мультимеров ЦД, расширено на белки применением пептидов и пептидомиметиков,которые аналогичным образом блокируют агрегацию белка. Для включения в композиции и процедуры по этому изобретению доступен широкий диапазон подходящих способов и антиагрегационных агентов. Агенты и способы модификации заряда и контроля рН Для улучшения транспортных характеристик биологически активных агентов (в том числе пептида,связывающегося с Y2-рецепторами, других активных пептидов и белков и лекарственных средств, представляющих собой макромолекулы и малые молекулы) с целью способствовать доставке через гидрофобные барьеры слизистой оболочки, это изобретение также предлагает методики и реагенты для модификации заряда биологически активных агентов или агентов, способствующих доставке, выбранных из описанных здесь. В этой связи относительные проникающие способности макромолекул обычно связаны с их коэффициентами распределения. Степень ионизации молекулы, которая зависит от рКа молекулы и от рН на поверхности слизистой оболочки, также влияет на проницаемость молекулы. Проникающей способности и распределению биологически активных агентов, включающих в себя пептид, связывающийся с Y2-рецепторами, и аналоги по этому изобретению, для доставки через слизистые оболочки можно способствовать изменением заряда или распределением заряда активного агента или агента, способствующего проникновению, что достигается, например, изменением заряда функциональных групп,модифицированием рН средства доставки или раствора, в котором доставляют активный агент, или согласованным введением реагента, изменяющего заряд или рН, с активным агентом. В соответствии с этими общими указаниями доставку, осуществляемую через слизистые оболочки,заряженных макромолекулярных веществ, в том числе пептида, связывающегося с Y2-рецепторами, и других биологически активных пептидов и белков, в способах и композициях по этому изобретению существенно улучшают при доставке активного агента через слизистую поверхность в существенно неионизированном или нейтральном по электрическому заряду состоянии. Определенный пептид, связывающийся с Y2-рецепторами, и другие биологически активные пептидные и белковые компоненты препаратов доставки через слизистые оболочки для применения по этому изобретению следует модифицировать по заряду для получения увеличения плотности положительного заряда пептида или белка. Эти модификации расширены также на катионизацию пептидных и белковых конъюгатов, носителей и других описанных здесь форм доставки. Катионизация дает удобный способ изменения биораспределения и транспортных свойств белков и макромолекул по этому изобретению. Катионизацию осуществляют таким способом, который существенно сохраняет биологическую активность активного агента и ограничивает потенциальные нежелательные побочные эффекты, включающие в себя повреждение ткани и токсичность. Агенты и способы ингибирования разлагающего фермента Другим наполнителем, который можно включать в препарат для доставки лекарственного средства через слизистые оболочки, является ингибитор разлагающего фермента. Примеры адгезивных по отно- 16008829 шению к слизистым оболочкам комплексов полимера с ингибитором фермента, которые являются полезными в препаратах и способах для доставки через слизистые оболочки по этому изобретению, включают в себя, без ограничения: карбоксиметилцеллюлозу-пепстатин (с антипепсиновой активностью); поли(акриловую кислоту)-ингибитор Боумана-Берка (антихимотрипсин); поли(акриловую кислоту)химостатин (антихимотрипсин); поли(акриловую кислоту)-эластатин (анти-эластаза); карбоксиметилцеллюлозу-эластатин (антиэластаза); поликарбофил-эластатин (антиэластаза); хитозан-антипаин (антитрипсин); поли(акриловую кислоту)-бацитрацин (антиаминопептидаза N); хитозан-ЭДТА (антиаминопептидаза N, антикарбоксипептидаза А); хитозан-ЭДТА-антипаин (антитрипсин, антихимотрипсин, антиэластаза). Как описано более подробно ниже, определенные варианты осуществления этого изобретения должны, возможно, включать новое производное хитозана или химически модифицированную форму хитозана. Одно такое новое производное для применения по этому изобретение обозначено как полимер -[14]-2-гуанидино-2-дезокси-D-глюкозы (поли-GuD). В композициях и способах по этому изобретению можно применять любой ингибитор, который ингибирует активность фермента для защиты биологически активного(ых) агента(ов). Полезные ингибиторы фермента для защиты биологически активных белков и пептидов включают в себя, например, соевый ингибитор трипсина, панкреатический ингибитор трипсина, ингибитор химотрипсина и ингибитор трипсина и химотрипсина, выделенный из клубней картофеля (Solanum tuberosum L). Можно использовать комбинации или смеси ингибиторов. Дополнительные ингибиторы протеолитических ферментов для применения по этому изобретению включают в себя овомукоидный фермент, мезилат габаксата, альфа 1 антитрипсин, апротинин, амастатин, бестатин, пуромицин, бацитрацин, лейпепсин, альфа 2 макроглобулин, пепстатин и ингибитор трипсина из яичного белка и соевых бобов. Эти и другие ингибиторы можно использовать в отдельности или в комбинации. Ингибитор(ы) можно включать в носитель или связывать с ним, примером чему является гидрофильный полимер, нанесенный в качестве покрытия на поверхность лекарственной формы, которая должна контактировать со слизистой оболочкой носовой полости, или включенный в наружную фазу поверхности в комбинации с биологически активным агентом или в препарат, который вводят отдельно (например предварительно). Количество ингибитора, например ингибитора протеолитического фермента, который, возможно,включен в композиции по этому изобретению, должно варьировать в зависимости от (а) свойств конкретного ингибитора, (б) числа функциональных групп, присутствующих в молекуле (с которыми можно провести взаимодействие для введения этиленовой ненасыщенности, необходимой для сополимеризация с мономерами, образующими гидрогель), и (в) числа лектиновых групп, таких как гликозиды, которые присутствуют в молекуле ингибитора. Оно может также зависеть от конкретного терапевтического агента, который предназначен для введения. Вообще говоря, полезное количество ингибитора фермента составляет приблизительно от 0,1 до 50 мг/мл, часто приблизительно от 0,2 до 25 мг/мл и, более обычно,приблизительно от 0,5 до 5 мг/мл препарата (то есть, отдельного препарата ингибитора протеазы или комбинированного препарата с ингибитором и биологически активным агентом). В случае ингибирования трипсина подходящие ингибиторы можно выбирать из, например, апротинина, BBI, соевого ингибитора трипсина, куриного овомукоида, куриного овоингибитора, человеческого панкреатического ингибитора трипсина, мезилата камостата, флавоноидных ингибиторов, антипаина,лейпептина, р-аминобензамидина, AEBSF, TLCK (тозиллизинхлорметилкетон), APMSF, DFP, PMSF и производных поли(акрилата). В случае ингибирования химотрипсина подходящие ингибиторы можно выбирать, например, из апротинина, BBI, соевого ингибитора трипсина, химостатина,бензилоксикарбонил-Pro-Phe-CHO, FK-448, куриного овоингибитора, комплексов сахара с бифениловыми кислотами, DFP, PMSF, -фенилпропионата, и производных поли(акрилата). В случае ингибирования эластазы подходящие ингибиторы можно выбирать, например, из эластатина, метоксискуцинил-Аlа-АlаPro-Val-хлорметилкетона (МРСМK), BBI, соевого ингибитора трипсина, куриного овоингибитора, DFP иPMSF. Дополнительные ингибиторы фермента для применения по этому изобретению выбирают из широкого диапазона небелковых ингибиторов, которые варьируют по степени их действенности и токсичности. Как описано более подробно ниже, можно легко осуществить иммобилизацию этих вспомогательных агентов на матриксах или других средствах доставки или разработку химически модифицированных аналогов, для снижения или даже элиминации токсичных эффектов в случае наличия таковых. Среди этой широкой группы кандидатных ингибиторов фермента для применения по этому изобретению есть фосфорорганические ингибиторы, такие как диизопропилфторфосфат (DFP) и фенилметилсульфонилфторид (PMSF), которые являются сильнодействующими необратимыми ингибиторами сериновых протеаз (например, трипсина и химотрипсина). Дополнительное ингибирование ацетилхолинэстеразы этими соединениями делает их сильно токсичными в условиях неконтролируемой доставки. Другой кандидатный ингибитор, 4-(2-аминоэтил)-бензолсульфонилфторид (AEBSF), имеет ингибиторную активность,сравнимую с DFP и PMSF, но он является заметно менее токсичным. (4-Аминофенил)метансульфонилфторида гидрохлорид (APMSF) является другим сильнодействующим ингибитором трипсина, но он токсичен в неконтролируемых условиях. В отличие от этих ингибиторов, 4-(4- 17008829 изопропилпиперадинокарбонил)-фенил-1,2,3,4,-тетрагидро-1-нафтоатметансульфонат (FK-448) является низкотоксичным веществом, будучи сильнодействующим и специфичным ингибитором химотрипсина. Дополнительным представителем этой небелковой группы кандидатов в ингибиторы, также проявляющими низкий риск токсичности, является мезилат камостата (N,N'-диметилкарбамоилметил-р-(р'гуанидинобензоилокси)-фенилацетатметансульфонат). Еще одним типом ингибирующих фермент агентов для применения в способах и композициях по этому изобретению являются аминокислоты и модифицированные аминокислоты, которые вмешиваются в ферментатическую деградацию конкретного терапевтического соединения. Для применения в этом контексте аминокислоты и модифицированные аминокислоты являются, по существу, нетоксичными, и их можно получать при низкой стоимости. Однако из-за их малого молекулярного размера и хорошей растворимости они легко разбавляются и абсорбируются в слизистых средах. Тем не менее, в надлежащих условиях аминокислоты могут действовать как обратимые конкурентные ингибиторы протеазных ферментов. Определенные модифицированные аминокислоты могут проявлять гораздо более сильную ингибиторную активность. Желаемая модифицированная аминокислота в этом контексте известна как ингибитор переходного состояния. Сильная ингибиторная активность этих соединений основана на их структурном сходстве с субстратом в его геометрии переходного состояния, причем их обычно выбирают так, что они имеют гораздо более высокое сродство к активному центру фермента по сравнению с самим субстратом. Ингибиторы переходного состояния представляют собой обратимые конкурентные ингибиторы. Примерами этого типа ингибитора являются производные -аминоборной кислоты, такие как боролейцин, боровалин и бороаланин. Атом бора в этих производных может образовывать тетраэдрический боронатный ион, который считается похожим на переходное состояние пептидов во время их гидролиза аминопептидазами. Эти производные аминокислот представляют собой сильнодействующие и обратимые ингибиторы аминопептидаз, и, по сообщениям, боролейцин является более чем в 100 раз более эффективным в ингибировании фермента, чем бестатин, и более чем в 1000 раз более эффективным,чем пуромицин. Другой модифицированной аминокислотой, относительно которой сообщается о сильной ингибирующей протеазу активности, является N-ацетилцистеин, который ингибирует ферментатическую активность аминопептидазы N. Этот вспомогательный агент также проявляет муколитические свойства, которые можно использовать в способах и композициях по этому изобретению для снижения эффектов диффузионного барьера в слизи. Еще одни полезные ингибиторы фермента для применения в способах согласованного введения и в комбинационных препаратах по этому изобретению можно выбирать из ингибиторов фермента, представляющих собой пептиды и модифицированные пептиды. Важным представителем этого класса ингибиторов является циклический додекапептид, бацитрацин, полученный из Bacillus licheniformis. В дополнение к этим типам пептидов определенные дипептиды и трипептиды проявляют слабую, неспецифичную ингибиторную активность по отношению к некоторым протеазам. По аналогии с аминокислотами, их ингибиторную активность можно улучшить химическими модификациями. Например, фосфинокислотные аналоги дипептида также представляют собой ингибиторы переходного состояния с сильной ингибиторной активностью по отношению к аминопептидазам. По сообщениям, их используют для стабилизации вводимого через нос лейцин-энкефалина. Другим примером аналога переходного состояния является модифицированный пенталептид пепстатин, который является очень сильнодействующим ингибитором пепсина. Структурный анализ пепстатина тестированием ингибиторной активности нескольких синтетических аналогов продемонстрировал основные структурно-функциональные характеристики молекулы, ответственные за эту ингибиторную активность. Другой особый тип модифицированного пептида включает в себя ингибиторы с концевой альдегидной функциональной группировкой в их структуре. Например, обнаружено, что последовательность бензилоксикарбонил-Pro-Phe-CHO, которая отвечает известным первичным и вторичным специфическим требованиям к химотрипсину, является сильнодействующим обратимым ингибитором этой целевой белказы. В данной области также известны химические структуры дополнительных ингибиторов с локализованной на конце альдегидной функциональной группировкой, например антипаина, лейпептина, химостатина и эластатина, а также структуры других известных обратимых ингибиторов, представляющих собой модифицированный пептид, таких как фосфорамидон, бестатин, пуромицин и амастатин. Из-за сравнительно высокой молекулярной массы полипептидные ингибиторы протеазы больше подходят для концентрированной доставки в матрикс носителя лекарственного средства, чем соединения меньших размеров. Дополнительные агенты для ингибирования протеазы в препаратах и способах по этому изобретению включают в себя применение комплексообразующих агентов. Эти агенты опосредуют ингибирование фермента, лишая среду носовой полости (или препаративной или терапевтической композиции) двухвалентных катионов, которые являются кофакторами многих протеаз. К примеру, комплексообразующие агенты ЭДТА и DTPA при согласованном введении или в качестве вспомогательных агентов, введенных в состав комбинационного препарата, в подходящей концентрации должны быть достаточными для ингибирования избранных протеаз, что тем самым способствует интраназальной доставке биологически активных агентов по этому изобретению. Дополнительными представителями этого класса ингибиторных агентов являются ЭГТА, 1,10-фенантралин и гидроксихинолин. Кроме того, из-за- 18008829 их склонности хелатировать двухвалентные катионы эти и другие комплексообразующие агенты являются полезными в этом изобретении как прямо способствующие абсорбции агенты. Как отмечено более детально здесь и в других местах, также подразумевается использование различных полимеров, особенно полимеров, адгезивных по отношению к слизистым оболочкам, в качестве агентов ингибирования фермента в способах и композициях по этому изобретению, представляющих собой согласованное введение, мультипроцессинг и/или комбинационный препарат. Например, производные поли(акрилат)а, такие как поли(акриловая кислота) и поликарбофил, могут влиять на активность различных протеаз, в том числе трипсина, химотрипсина. Ингибиторный эффект этих полимеров может также быть основанным на комплексации двухвалентных катионов, таких как Са 2+ и Zn2+. Дополнительно подразумевается, что эти полимеры могут служить как партнеры конъюгации или носители для дополнительных агентов, ингибирующих фермент, которые описаны выше. Например, был разработан конъюгат хитозан-ЭДТА, который является полезным в этом изобретении и проявляет сильные ингибиторные эффекты по отношению к энзиматической активности цинкзависимых протеаз. Не ожидается,что свойства адгезивности к слизистым оболочкам у полимеров после ковалентного присоединения других ингибиторов фермента будут в этом контексте существенно ослаблены, как не ожидается и то, что будет уменьшена общая применимость таких полимеров в качестве средства доставки биологически активных агентов по этому изобретению. Напротив, уменьшенное расстояние между средством доставки и слизистой поверхностью, которое создает механизм адгезивности к слизистым, должно минимизировать досистемный метаболизм активного агента, в то время как ковалентно связанные ингибиторы фермента остаются концентрированными в месте доставки лекарственного средства, минимизируя нежелательные эффекты разведения ингибиторов, а также вызываемые ими токсичные и другие побочные эффекты. Таким образом, эффективное количество согласованно введенного ингибитора фермента можно снизить,благодаря исключению эффектов разведения. Примеры комплексов полимера и ингибитора фермента, которые являются адгезивными к слизистым и полезными в препаратах для доставки через слизистые и в способах по этому изобретению,включают в себя без ограничения: карбоксиметилцеллюлозу-пепстатин (с антипепсиновой активностью); поли(акриловую кислоту)-ингибитор Боумана-Брка (антихимотрипсин); поли(акриловую кислоту)химостатин (антихимотрипсин); поли(акриловую кислоту)-эластатин (антиэластаза); карбоксиметилцеллюлозу-эластатин (антиэластаза); поликарбофил-эластатин (антиэластаза); хитозан-антипаин (антитрипсин); поли(акриловую кислоту)-бацитрацин (антиаминопептидаза N); хитозан-ЭДТА (антиаминопептидаза N, антикарбоксипептидаза А); хитозан-ЭДТА-антипаин (антитрипсин, антихимотрипсин, антиэластаза). Муколитические и удаляющие слизь агенты и способы Эффективная доставка биотерапевтических агентов интраназальным введением должна учитывать снижение скорости транспорта лекарственного средства через защитную слизевую выстилку слизистой оболочки носовой полости вдобавок к потере лекарственного средства из-за связывания с гликобелками слоя слизи. Нормальная слизь является вязко-эластичной гелеподобной субстанцией, состоящей из воды,электролитов, муцинов, макромолекул и затопленных в ней эпителиальных клеток. Она служит главным образом в качестве цитозащитного и смазывающего покрытия для находящихся под ней слизистых тканей. Слизь секретируют случайным образом распределенные секреторные клетки, находящиеся в эпителии носовой полости и в других слизистых эпителиях. Структурной единицей слизи является муцин. Этот гликопротеин является, главным образом, ответственным за вязко-эластичную природу слизи, хотя другие макромолекулы также могут вносить вклад в это свойство. В слизи дыхательных путей такие макромолекулы включают в себя продуцируемые на месте секреторные IgA, IgM, IgE, лизоцим и бронхотрансферрин, которые также играют важную роль в защитных механизмах хозяина. Способы согласованного введения по этому изобретению, возможно, включают эффективные муколитические или удаляющие слизь агенты, которые служат для разложения, истончения или удаления слизи из слизистых поверхностей носовой полости с целью облегчения абсорбции биотерапевтических агентов, вводимых через нос. В этих способах муколитический или удаляющий слизь агент согласованно вводят в качестве вспомогательного соединения для способствования интраназальной доставке биологически активного агента. Или же эффективное количество муколитического или удаляющего слизь агента включают в качестве агента процессинга в способе мультипроцессинга по этому изобретению или в качестве добавки в комбинационном препарате по этому изобретению для получения улучшенного препарата, который способствует интраназальной доставке биотерапевтического соединения, снижая барьерные эффекты слизи носовой полости. Для включения в способы и композиции по этому изобретению доступно множество разных муколитических или удаляющих слизь агентов. На основании механизмов их действия муколитические и удаляющие слизь агенты часто можно классифицировать по нижеследующим группам: протеазы (например, проназа, папаин), которые расщепляют белковую сердцевину муциновых гликобелков; сульфгидрильные соединения, которые расщепляют дисульфидные связи мукобелка; и детергенты (например,Triton X-100, Tween 20), которые разрушают нековалентные связи в слизи. Дополнительные соединения в этом контексте включают в себя, без ограничения, соли желчных кислот и поверхностно-активные- 19008829 агенты, например, дезоксихолат натрия, тауродезоксихолат натрия, гликохолат натрия и лизофосфатидилхолин. Эффективность солей желчных кислот в структурном разрушении слизи имеет такой порядок: дезоксихолаттаурохолатгликохолат. Другие эффективные агенты, которые снижают вязкость или адгезию слизи для способствования интраназальной доставке в соответствии со способами по этому изобретению, включают в себя, например, короткоцепочечные жирные кислоты и муколитические агенты,которые действуют хелатированием, такие как N-ацилколлагеновые пептиды, желчные кислоты и сапонины (последние действуют частично хелатированием Са 2+ и/или Mg2+, которые играют важную роль в подержании структуры слоя слизи). Дополнительные муколитические агенты для применения в способах и композициях по этому изобретению включают в себя N-ацетил-L-цистеин (ACS), сильнодействующий муколитический агент, который снижает как вязкость, так и клейкость бронхо-легочной слизи и, по сообщениям, умеренно увеличивает биологическую доступность через нос для человеческого гормона роста у анестезированных крыс(от 7,5 до 12,2%). Эти и другие муколитические или удаляющие слизь агенты приводят в контакт со слизистой мембраной носа, в типичных случаях в диапазоне концентраций приблизительно от 0,2 до 20 мМ,согласованно с введением биологически активного агента для снижения полярной вязкости и/или эластичности слизи в носу. Кроме того, другие муколитические или удаляющие слизь агенты можно выбирать из ряда ферментов гликозидаз, которые способны расщеплять гликозидные связи в гликопротеине слизи. Репрезентативными для этого класса ферментов являются -амилаза и -амилаза, хотя их муколитические эффекты могут быть ограниченными. Напротив, бактериальные гликозидазы позволяют этим микроорганизмам проникать через слой слизи их хозяев. Неионные детергенты обычно также являются полезными в качестве муколитических или удаляющих слизь агентов для комбинационного применения с большинством биологически активных агентов по этому изобретению, в том числе пептидными и белковыми терапевтическими средствами. Эти агенты в типичных случаях не должны модифицировать или существенно нарушать активность терапевтических полипептидов. Цилиостатические агенты и способы Из-за того, что самоочищающая способность определенных слизистых тканей (например, носовых слизистых тканей) мукоцилиарным очищением является необходимой в качестве защитной функции(например, для удаления пыли, аллергенов и бактерий), обычно считают, что эту функцию не следует существенно нарушать лечением через слизистые. Мукоцилиарный транспорт в респираторном тракте является особенно важным защитным механизмом против инфекций. Для достижения этой функции биение ресничек в носовых и дыхательных проходах движет слой слизи вдоль слизистой оболочки для удаления частиц и микроорганизмов, попавших туда при вдохе. Цилиостатические агенты находят применение в способах и композициях по этому изобретению для увеличения времени удержания вводимых через слизистые (например, через нос) пептидов, связывающихся с Y2-рецепторами, аналогов и миметиков и других биологически активных агентов, которые здесь раскрыты. В частности, доставке этих агентов в способах и композициях по этому изобретению значительно способствует в определенных аспектах согласованное введение или комбинационный препарат одного или нескольких из цилиостатических агентов, которые действуют для обратимого ингибирования активности ресничек клеток слизистой оболочки с целью обеспечивать временное обратимое увеличение времени удержания активного(ых) агент(ов), вводимого(ых) через слизистые. Для применения по этим аспектам этого изобретения вышеуказанные цилиостатические факторы, либо специфичные,либо непрямые по их активности, все являются кандидатами для успешного использования в качестве цилиостатических агентов в надлежащих количествах (в зависимости от концентрации, длительности и способа доставки), таких, что они обеспечивают временное (то есть, обратимое) снижение или прекращение удаления слизи ресничками на слизистой в месте введения для способствования доставке пептида,связывающегося с Y2-рецепторами, аналогов и миметиков и других биологически активных агентов,которые здесь раскрыты, без неприемлемых нежелательных побочных эффектов. В более детальных аспектах используют конкретный цилиостатический фактор в комбинированном препарате или протоколе согласованного введения с одним или более чем одним из пептидов, связывающихся с Y2-рецепторами, белков, аналогов и миметиков и/или других биологически активных агентов, которые здесь раскрыты. В этих вариантах осуществления этого изобретения можно использовать различные бактериальные цилиостатические факторы, выделенные и охарактеризованные в литературе. Цилиостатические факторы из бактерии Pseudomonas aeruginosa включают в себя производное феназина,пиосоединение (2-алкил-4-гидроксихинолины) и рамнолипид (также известный как гемолизин). Пиосоединение вызывает цилиостаз при концентрации 50 мкг/мл и без очевидных ультраструктурных поражений. Производное феназина также ингибирует подвижность ресничек, но вызывает некоторое разрушение мембран, хотя при существенно более высоких концентрациях 400 мкг/мл. Ограниченное взаимодействие эксплантов трахеи с рамнолипидом приводит к цилиостазу, который ассоциирован с изменени- 20008829 ем реснитчатых мембран. Более длительное взаимодействие с рамнолипидом ассоциировано с удалением ветвей динеина из аксонем. Поверхностно-активные агенты и способы В более детальных аспектах этого изобретения можно использовать один или более агентов, способствующих проникновению через мембраны, в способе доставки через слизистые или препарате по этому изобретению для способствования доставке, осуществляемой через слизистые оболочки, пептидов,связывающихся с Y2-рецепторами, белков, аналогов и миметиков и других биологически активных агентов, которые здесь раскрыты. Агенты, способствующие проникновению через мембраны, в этом контексте можно выбирать из: (i) поверхностно-активного агента, (ii) соли желчной кислоты, (ii) фосфолипидной добавки, смешанной мицеллы, липосомы или носителя, (iii) спирта, (iv) енамина, (v) соединения,являющегося донором NO, (vi) длинноцепочечной амфипатической молекулы, (vii) малого гидрофобного агента, способствующего проникновению, (viii) производного натрия или салициловой кислоты; (ix) глицеринового эфира ацетоуксусной кислоты; (х) производного циклодекстрина или бета-циклодекстрина,(xi) жирной кислоты с цепью средней длины, (xii) хелатирующего агента, (xiii) аминокислоты или ее соли, (xiv) N-ацетиламинокислоты или ее соли, (xv) фермента, разлагающего выбранный компонент мембраны, (xvi) ингибитора синтеза жирных кислот или (xvii) ингибитора синтеза холестерина, или (xviii) любой комбинации агентов, способствующих проникновению через мембраны, которые указаны в (i)(xviii). Определенные поверхностно-активные агенты легко включать в препараты для доставки через слизистые оболочки и в способы по этому изобретению в качестве агентов, способствующих абсорбции через слизистые оболочки. Эти агенты, которые можно согласованно вводить или можно комбинированно включать в один препарат с пептидами, связывающимися с Y2-рецепторами, белками, аналогами и миметиками и другими биологически активными агентами, которые здесь раскрыты, можно выбирать из обширной совокупности известных поверхностно-активных агентов. Поверхностно-активные агенты обычно делятся на три класса: (1) неионные эфиры полиоксиэтилена; (2) соли желчных кислот, такие как натрия гликохолат (SGC) и дезоксихолат (DOC); и (3) производные фузидовой кислоты, такие как натрия тауродигидрофузидат (STDHF). Механизмы действия этих различных классов поверхностно-активных агентов в типичных случаях включают в себя солюбилизацию биологически активного агента. Для белков и пептидов, которые часто формируют агрегаты, поверхностно-активные свойства этих промоторов абсорбции могут сделать возможными такие взаимодействия с белками, что более мелкие единицы, такие как покрытые поверхностно-активным агентом мономеры, могут более легко поддерживаться в растворе. Примерами других поверхностно-активных агентов являются Lфосфатидилхолиндидеканоил(DDPC), полисорбат 80 и полисорбат 20. Эти мономеры предположительно являются более транспортабельными единицами, чем агрегаты. Вторым потенциальным механизмом является защита пептида или белка от протеолитической деградации протеазами в среде слизистых оболочек. Как соли желчных кислот, так и некоторые производные фузидовой кислоты, по сообщениям, ингибируют протеолитическую деградацию белков гомогенатами носа при концентрациях, меньших, чем те, или эквивалентных тем,которые требуются для способствования абсорбции белка. Это ингибирование протеазы может быть особенно важным для пептидов с короткими биологическими периодами полужизни. Ферменты разложения и ингибиторы синтеза жирных кислот и холестерина В связанных аспектах этого изобретения пептиды, связывающиеся с Y2-рецепторами, белки, аналоги и миметики и другие биологически активные агенты для введения через слизистые вводят в один состав или согласованно вводят с агентом, способствующим проникновению, выбираемым из фермента деградации, или агентом, стимулирующим метаболизм, или ингибитором синтеза жирных кислот, стеролов или другие выбранных компонентов эпителиального барьера (патент США 6190894). Например,разлагающие ферменты, такие как фосфолипаза, гиалуронидаза, нейраминидаза и хондлитиназа, можно использовать для способствования проникновению через слизистые пептида, связывающегося с Y2 рецепторами, белков, аналогов и миметиков и других биологически активных агентов без причинения необратимого повреждения слизистому барьеру. В одном варианте осуществления хондроитиназу используют в способе или композиции, предложенных здесь, для изменения гликобелковых или гликолипидных составных частей барьера проникновению через слизистую мембрану, тем самым, способствуя абсорбции, осуществляемой через слизистые оболочки, пептида, связывающегося с Y2-рецепторами,белков, аналогов и миметиков и других биологически активных агентов, которые здесь раскрыты. Что касается ингибиторов синтеза составных частей слизистого барьера, отмечено, что свободные жирные кислоты составляют 20-25% эпителиальных липидов по массе. Двумя ограничивающими скорость ферментами в биосинтезе свободных жирных кислот являются ацетилКоА-карбоксилаза и синтетаза жирных кислот. Через ряд стадий свободные жирные кислоты метаболизируются в фосфолипиды. Таким образом, ингибиторы синтеза и метаболизма свободных жирных кислот для применения в способах и композициях по этому изобретению включают в себя, без ограничения, ингибиторы ацетилКоАкарбоксилазы, такие как 5-тетрадецилокси-2-фуранкарбоновая кислота (TOFA); ингибиторы синтетазы жирных кислот; ингибиторы фосфолипазы А, такие как гомизин А, 2-(п-амилциннамил)-амино-4 хлорбензойная кислота, бромфенацилбромид, моноалид, 7,7-диметил-5,8-эйкозадиеноевая кислота, ни- 21008829 церголин, цефарантин, никардипин, кверцетин, дибутирилциклоАМФ, R-24571, N-олеоилэтаноламин, N(7-нитро-2,1,3-бензоксадиазол-4-ил)-фосфатидилсерин, циклоспорин А, местные анестетики, в том числе дибукаин, фениламин, ретиноиды, такие как полностью транс- и 13-цис-ретиноевая кислота, W-7, трифторперазин, R-24571 (калмидазолий, 1-гексадоцил-3-трифторэтилглицеро-sn-2-фосфоментол (MJ33); блокаторы каналов для кальция, в том числе никардипин, верапамил, дилтиазем, нифедипин и нимодипин; антималярийные средства, в том числе хинакрин, мепакрин, хлорохин и гидроксихлорохин; бетаблокаторы, в том числе пропранолол и лабеталол; антагонисты кальмодулина; EGTA; тимерсол; глюкокортикостероиды, в том числе дексаметазон и преднизолон, и нестероидные противовоспалительные агенты, в том числе индометацин и напроксен. Свободные стеролы, главным образом холестерин, составляют 20-25% эпителиальных липидов по массе. Ограничивающим скорость ферментом в биосинтезе холестерина является 3-гидрокси-3 метилглутарил (ГМГ)КоА-редуктаза. Ингибиторы синтеза холестерина для применения в способах и композициях по этому изобретению включают в себя, без ограничения, конкурентные ингибиторы ГМГКоА-редуктазы, такие как симвастатин, ловастатин, флуиндостатин (флувастатин), правастатин,мевастатин, а также другие ингибиторы ГМГКоА-редуктазы, такие как олеат холестерина, сульфат и фосфат холестерина и оксигенированные стеролы, такие как 25-ОН- и 26-ОН-холестерин; ингибиторы синтетазы сквалена; ингибиторы эпоксидазы сквалена; ингибиторы дельта 7- или дельта 24-редуктаз, такие как 22,25-диазахолестерин, 20,25-диазахолестанол, AY9944 и трипаранол. Каждый из ингибиторов синтеза жирных кислот или ингибиторов синтеза стеролов можно согласованно вводить или можно комбинировать в составе с одним или несколькими из белков, аналогов и миметиков пептида, связывающегося с Y2-рецепторами, и других биологически активных агентов, описанных здесь, для достижения усиленного эпителиального проникновения активного(ых) агента(ов). Диапазон эффективных концентрации ингибитора стеролов в терапевтическом или вспомогательном препарате для доставки через слизистые оболочки составляет обычно приблизительно от 0,0001 до 20 мас.% от суммарной массы, в более типичных случаях приблизительно от 0,01 до 5%. Способы и агенты, являющиеся донорами оксида азота В других связанных аспектах этого изобретения донор оксида азота (NO) выбирают в качестве агента, способствующего проникновению через мембраны, для способствования доставке через слизистые одного или нескольких из белков, аналогов и миметиков пептида, связывающегося с Y2 рецепторами, и других биологически активных агентов, описанных здесь. В данной области известны различные доноры NO, применимые при эффективных концентрациях в способах и препаратах по этому изобретению. Примеры доноров NO включают в себя, без ограничения, нитроглицерин, нитропруссид,NOC5 [3-(2-гидрокси-1-(метилэтил)-2-нитрозогидразино)-1-пропанамин], NOC12 [N-этил-2-(1-этилгидрокси-2-нитрозогидразино)этанамин], SNAP [S-нитрозо-N-ацетил-DL-пеницилламин], NORI и NOR4. В способах и композициях по этому изобретению эффективное количество выбранного донора NO согласованно вводят в или через слизистый эпителий или комбинируют вместе с одним или несколькими из белков, аналогов и миметиков пептида, связывающегося с Y2-рецепторами, и/или других биологически активных агентов, описанных здесь. Агенты для модулирования структуры и/или физиологии эпителиальных стыков Данное изобретение предлагает фармацевтическую композицию, которая содержит один или несколько из белков, аналогов и миметиков пептида, связывающегося с Y2-рецепторами, и(или) других биологически активных агентов в комбинации с агентами, способствующими доставке через слизистые,описанными здесь, введенными в состав фармацевтического препарата для доставки через слизистые оболочки. Агент проницаемости обратимо способствует параклеточному транспорту через слизистый эпителий, в типичных случаях модулированием структуры и/или физиологии эпителиальных стыков на поверхности слизистого эпителия в субъекте. Этот эффект в типичных случаях вовлекает ингибирование агентом проницаемости гомотипических или гетеротипических связей между адгезивными белками соседствующих эпителиальных клеток эпителиальной мембраны. Целевые белки этого блокирования гомотипического или гетеротипического связывания можно выбирать из различных родственных стыковых молекул адгезии (СМА), окклюдинов или клаудинов. В других дополнительных подробных вариантах осуществления это изобретение предлагает увеличивающие проницаемость пептиды и аналоги и миметики пептидов для способствования параклеточному транспорту через слизистый эпителий. Эти пептиды и аналоги и миметики пептида в типичных случаях действуют в композициях и способах по этому изобретению модулированием структуры и/или физиологии эпителиальных стыков в субъекте, представляющем собой млекопитающее. В определенных вариантах осуществления эти пептиды и аналоги и миметики пептида эффективно ингибируют гомотипическое и/или гетеротипическое связывание адгезивных белков эпителиальной мембраны, выбранных из стыковой молекулы адгезии (СМА), окклюдина или клаудина. Одним таким агентом, который был подробно исследован, является бактериальный токсин из Vibriocholerae, известный как "токсин запирающей зоны" (ZOT). Этот токсин опосредствует увеличение проницаемости слизистой кишечника и вызывает симптомы заболевания, включающие в себя диарею, у ин- 22008829 фицированных субъектов: Fasano et al, Proc. Nat. Acad. Sci., U.S.A., 8:5242-5246 (1991). При тестировании на слизистой оболочке тонкой кишки кролика ZOT увеличивал кишечную проницаемость модулированием структуры межклеточных плотных стыков. Более недавно было найдено, что ZOT способен обратимо открывать плотные стыки в кишечной слизистой оболочке. Также сообщалось, что ZOT способен обратимо открывать плотные стыки в слизистой оболочке носовой полости. Патент США 5908825. В способах и композициях по этому изобретению ZOT, а также различные аналоги и миметикиZOT, которые действуют как агонисты или антагонисты активности ZOT, являются полезными для способствования интраназальной доставке биологически активных агентов увеличением параклеточный абсорбции в (через) слизистую оболочку носа. В этом контексте ZOT в типичных случаях действует, вызывая структурную реорганизацию плотных стыков, характеризующуюся изменением локализации стыкового белка ZO1. В этих аспектах настоящего изобретения ZOT согласованно вводят или комбинируют в одном препарате с биологически активным агентом в эффективном количестве для получения значительно усиленной абсорбции активного агента обратимым увеличением проницаемости слизистых оболочек носовой полости без существенных нежелательных побочных эффектов. Вазодилятаторные агенты и способы Еще одним классом способствующих абсорбции агентов, показывающих выгодную применимость в способах и композициях по этому изобретению, которые представляют собой согласованное введение и комбинационный препарат, являются вазоактивные соединения, более конкретно, вазодилятаторы. Эти соединения действуют в настоящем изобретении модулированием структуры и физиологии сосудистой системы под слизистыми, увеличивая скорость транспорта пептида, связывающегося с Y2-рецепторами,его аналогов и миметиков и других биологически активных агентов в или через слизистый эпителий и/или в конкретные целевые ткани или компартменты (например, системное кровообращение или центральная нервная система). Вазодилятаторные агенты для применения в этом изобретении в типичных случаях вызывают расслабление кровеносных сосудов под слизистой оболочкой либо уменьшением цитоплазматического кальция, либо увеличением оксида азота (NO), либо ингибированием киназы легких цепей миозина. Их обычно подразделяют на 9 классов: антагонисты кальция, открыватели каналов для калия, ингибиторы ангиотензинконвертирующего фермента, антагонисты рецепторов ангиотензина-II, антагонисты адренергических рецепторов и рецепторов имидазола, 1-адренергические агонисты, ингибиторы фосфодиэстеразы, эйкозаноиды и доноры NO. Несмотря на химические различия, фармакокинетические свойства антагонистов кальция являются одинаковыми. Абсорбция в системное кровообращение является высокой, и поэтому эти агенты претерпевают значительный метаболизм первого прохождения в печени, приводящий к индивидуальным вариациям в фармакокинетике. Кроме более новых лекарственных средств дигидропиридинового типа (амлодипин, фелодипин, исрадипин, нилвадипин, низолдипин и нитрендипин) антагонисты кальция имеют короткий период полужизни. Поэтому для поддержания эффективной концентрации лекарственного средства для многих из них может требоваться доставка множественной дозировкой или препаратами контролируемого высвобождения, как описано здесь и в других местах. Лечение открывателем каналов для калия миноксидилом также может быть ограничено в способе и уровне введения из-за потенциальных нежелательных побочных эффектов. Ингибиторы ангиотензин-конвертирующего фермента предотвращают превращение ангиотензина-I в ангиотензин-II и являются наиболее эффективными, когда увеличена продукция ренина. Поскольку ангиотензин-конвертирующий фермент является идентичным кининазе-II, которая инактивирует сильнодействующий эндогенный вазодилятатор брадикинин, ингибирование ангиотензин-конвертирующего фермента вызывает снижение деградации брадикинина. Ингибиторы ангиотензин-конвертирующего фермента обеспечивают дополнительную выгоду, состоящую в защищающих и репарирующих сердце эффектах, предотвращением и обращением вспять фиброза сердца и гипертрофии желудочков в моделях на животных. Преобладающим путем выведения большинства ингибиторов ангиотензинконвертирующего фермента является экскреция почками. Поэтому почечные нарушения ассоциированы со сниженной его элиминацией, и для пациентов с умеренными почечными нарушениями рекомендуется снижение дозировки на 25-50%. Что касается доноров NO, эти соединения являются особенно полезными в этом изобретении из-за их дополнительного влияния на проницаемость слизистых оболочек. Вдобавок к вышеуказанным донорам NO, комплексы NO с нуклеофилами, называемые NO/нуклеофилы или NONO-аты, спонтанным и неферментатическим образом высвобождают NO при растворении в водном растворе при физиологическом рН. Напротив, нитровазодилятаторы, такие как нитроглицерин, требуют специфической энзиматической активности для высвобождения NO. NONO-аты высвобождают NO с определенной стехиометрией и при предсказуемых скоростях в диапазоне от 3 мин для диэтиламина/NO до приблизительно 20 ч для диэтилентриамина/NO (DETANO). В определенных способах и композициях по этому изобретению выбранный вазодилятаторный агент согласованно вводят (например, системно или через нос, одновременно или в комбинированной- 23008829 эффективной временной ассоциации) или в комбинированном составе с одним или более из пептидов,связывающихся с Y2-рецепторами, аналогов и миметиков и других(ого) биологически активных(ого) агентов(а) в количестве, которое является эффективным в способствовании абсорбции, осуществляемой через слизистые оболочки, активных(ого) агентов(а) для достижения целевой ткани или компартмента в субъекте (например, печени, портальной вены печени, ткани или жидкости ЦНС или плазмы крови). Агенты и способы, способствующие селективному транспорту Композиции и способы доставки по этому изобретению, возможно, включают агент, способствующий селективному транспорту, который облегчает транспорт одного или нескольких из биологически активных агентов. Эти способствующие транспорту агенты можно использовать в комбинационном препарате или протоколе согласованного введения с одним или несколькими из белков, аналогов и миметиков пептида, связывающегося с Y2-рецепторами, описанных здесь, для согласованного способствования доставке одного или нескольких из дополнительных биологически активных агентов через барьеры транспорта через слизистые с целью способствования доставке через слизистые активного(ых) агента(ов) для достижения целевой ткани или компартмента в субъекте (например, слизистого эпителия, печени,ткани или жидкости ЦНС или плазмы крови). Или же, способствующие транспорту агенты можно использовать в комбинационном препарате или протоколе согласованного введения для прямого способствования доставке, осуществляемой через слизистые, одного или нескольких из белков, аналогов и миметиков пептида, связывающегося с Y2-рецепторами, в сочетании или без сочетания с усиленной доставкой дополнительного биологически активного агента. Примеры агентов, способствующих селективному транспорту, для применения по этому аспекту настоящего изобретения включают в себя, без ограничения, гликозиды, сахарсодержащие молекулы и связывающиеся с сахаром агенты, такие как лектиновые связывающиеся агенты, которые известны специфическим взаимодействием с компонентами барьера для эпителиального транспорта. Например, в качестве носителей или конъюгированных медиаторов транспорта для способствования доставке через слизистые оболочки, например через слизистые оболочки носовой полости, биологически активных агентов по этому изобретению можно использовать конкретные "биоадгезивные" лиганды, в том числе,различные растительные и бактериальные лектины, которые связываются с группировками сахаров поверхности клетки опосредованными рецепторами взаимодействиями. Определенные биоадгезивные лиганды для применения по этому изобретению опосредуют передачу биологических сигналов эпителиальным целевым клеткам, которые запускают селективное поглощение адгезивного лиганда посредством специализированных процессов клеточного транспорта (эндоцитоз или трансцитоз). Поэтому эти медиаторы транспорта можно использовать в качестве "системы носителей" для стимуляции или прямого селективного поглощения одного или нескольких из белков, аналогов и миметиков пептида, связывающегося с Y2-рецепторами, и других биологически активных агентов в и(или) через слизистые эпителии. Эти и другие агенты, способствующие селективному транспорту, значительно способствуют доставке, осуществляемой через слизистые оболочки, макромолекулярных биофармацевтических средств (особенно пептидов, белков, олигонуклеотидных и полинуклеотидных векторов) по этому изобретению. Лектины представляют собой растительные белки, которые связываются со специфическими сахарами, находящимися на поверхности гликобелков и гликолипидов эукариотических клеток. Концентрированные растворы лектинов имеют мукоаттрактивный эффект, и различные исследования продемонстрировали быстрый опосредованный рецепторами эндоцитоз (RME) лектинов и лектиновых конъюгатов (например,конканавалин А, конъюгированный с коллоидными частицами золота) через слизистые поверхности. Дополнительные исследования сообщили, что механизмы поглощения лектинов можно использовать для нацеливания кишечных лекарственных средств in vivo. В некоторых из этих исследований полистироловые наночастицы (500 нм) были ковалентно связаны с лектином томата, и сообщается о достижении улучшенного системного поглощения после перорального введения крысам. В дополнение к растительным лектинам микробные факторы адгезии и инвазии дают богатый источник кандидатов для применения в качестве адгезивных/селективных транспортных носителей в способах и композициях для доставки через слизистые оболочки по этому изобретению. Два компонента являются необходимыми для процессов бактериального прикрепления, бактериальный адгезин (фактор прикрепления или колонизации) и рецептор на поверхности хозяйской клетки. Бактериям, вызывающим инфекции слизистых, нужно проникнуть через слой слизи для прикрепления к эпителиальной поверхности. Это присоединение обычно опосредствовано бактериальными волосковыми или бахромчатыми структурами, хотя в этом процессе могут участвовать другие компоненты клеточной поверхности. Прикрепившиеся бактерии колонизируют слизистые эпителии размножением и инициацией ряда биохимических взаимодействий внутри целевой клетки через механизмы трансдукции сигналов (с помощью или без помощи токсинов). Известно большое разнообразие ассоциированных с этими инвазивными механизмами биоадгезивных белков (например, инвазии, интерналин), исходно продуцируемых различными бактериями и вирусами. Они делают возможным экстраклеточное присоединение таких микроорганизмов при впечатляющей селективности по отношению к видам хозяев и даже к конкретным целевым тканям. Сигналы, передаваемые такими рецептор-лигандными взаимодействиями, запускают транспорт интактных живых микроорганизмов в и, в конце концов, через эпителиальные клетки эндо- и трансцитоз- 24008829 ными способами. Такие встречающиеся в природе феномены можно приспособить (например, образованием комплекса биологически активных агентов, таких как пептид, связывающийся с Y2-рецепторами, с адгезинами) как указано здесь для способствования доставке биологически активных соединений в или через слизистые эпителии и/или к другим намеченным целевым местам действия лекарственного средства. Различные бактериальные и растительные токсины, которые связываются с эпителиальными поверхностями специфичным лектиноподобным образом, также являются полезными в способах и композициях по этому изобретению. Например, дифтерийный токсин (ДТ) быстро поступает в хозяйские клетки путем эндоцитоза, опосредованного рецепторами. Аналогично, В-субъединица термолабильного токсина Е. coli связывается с ворсинчатой каймой кишечных эпителиальных клеток весьма специфичным лектиноподобным образом. Сообщается о поглощении этого токсина и трансцитозе в базолатеральную сторону энтероцитов in vivo и in vitro. В других исследованиях экспрессировали трансмембранный домен дифтерийного токсина в Е. coli в виде слитого белка с белком связывания мальтозы и химическим путем соединяли с высокомолекулярным поли-L-лизином. Получившийся комплекс успешно использовали для опосредования интернализации репортерного гена in vitro. Вдобавок к этим примерам, Staphylococcusaureus продуцирует набор белков (например, стафилококковый энтеротоксин A (SEA), SEB, токсин-1 синдрома токсического шока (TSST-1), которые действуют и как суперантигены, и как токсины. В исследованиях, связанных с этими белками, сообщается о дозозависимом усиленном трансцитозе SEB иTSST-1 в клетки Сасо-2. Вирусные гемагглютинины составляют другой тип транспортных агентов для способствования доставке, осуществляемой через слизистые оболочки, биологически активных агентов в способах и композициях по этому изобретению. Начальной стадией во многих вирусных инфекциях является связывание поверхностных белков (гемагглютининов) с клетками слизистых. Эти связывающиеся белки были идентифицированы для большинства вирусов, в том числе ротавирусов, вируса опоясывающего лишая, вируса леса Семлики, аденовирусов, вируса свертывания листьев картофеля и реовируса. Эти и другие примеры вирусных гемагглютининов можно использовать в комбинационном препарате (например, препарате, представляющем собой смесь или конъюгат) или в протоколе согласованного введения с одним или более из пептидов, связывающихся с Y2-рецепторами, их аналогов и миметиков, описанных здесь, для согласованного способствования доставке, осуществляемой через слизистые оболочки, одного или нескольких из дополнительного(ых) биологически активного(ых) агента(ов). Или же вирусные гемагглютинины можно использовать в комбинационном препарате или протоколе согласованного введения для прямого способствования доставке через слизистые одного или нескольких из белков, аналогов и миметиков пептида, связывающегося с Y2-рецепторами, в сочетании или без сочетания со способствованием доставке дополнительного биологически активного агента. Множество разных эндогенных, селективных опосредствующих транспорт факторов также является доступным для применения по этому изобретению. Клетки млекопитающего развили ряд механизмов для облегчения интернализации конкретных субстратов и нацеливания их в определенные компартменты. Все вместе эти процессы деформации мембран названы 'эндоцитозом' и включают в себя фагоцитоз,пиноцитоз, опосредованный рецепторами эндоцитоз (ОРЭ) (опосредованный клатрином ОРЭ) и потоцитоз (не опосредованный клатрином ОРЭ). ОРЭ является весьма специфичным клеточным биологическим процессом, посредством которого, как подразумевает его название, различные лиганды связываются с рецепторами на поверхности клетки и затем интернализуются и перемещаются в клетке. Во многих клетках процесс эндоцитоза является столь активным, что вся поверхность мембраны подвергается интернализации менее чем за полчаса. Предложены два класса рецепторов на основании их ориентации в клеточной мембране; аминоконец рецепторов типа I находится на экстраклеточной стороне мембраны,тогда как рецепторы типа II имеют тот же конец белка во внутриклеточной среде. Другие варианты осуществления этого изобретения используют трансферрин в качестве носителя или стимулятора ОРЭ при доставке, осуществляемой через слизистые оболочки, биологически активных агентов. Трансферрин, гликопротеин с молекулярной массой 80 кДа, транспортирующий железо, эффективно захватывается клетками посредством ОРЭ. Рецепторы трансферрина найдены на поверхности большинства пролиферирующих клеток, в повышенном числе на эритробластах и на многих видах опухолей. Трансцитоз трансферрина (Tf) и конъюгатов трансферрина, по сообщениям, усиливается в присутствии брефелдина A (BFA), грибкового метаболита. В других исследованиях сообщалось, что обработка при использовании BFA быстро увеличивает апикальный эндоцитоз как рицина, так и пероксидазы хрена в клетки MDCK. Таким образом, BFA и другие агенты, которые стимулируют опосредованный рецепторами транспорт, можно использовать в способах по этому изобретению и как скомбинированные(например, конъюгированные), и/или как согласованно вводимые агенты для способствования опосредованному рецепторами транспорту биологически активных агентов, в том числе белков, аналогов и миметиков пептида, связывающегося с Y2-рецепторами. Полимерные средства доставки и способы В определенных аспектах этого изобретения белки, аналоги и миметики пептида, связывающегося сY2-рецепторами, другие биологически активные агенты, которые здесь раскрыты, и агенты, способст- 25008829 вующие доставке, как описано выше, индивидуальным или комбинационным образом включают в препарат для доставки через слизистые оболочки (например, через нос), содержащий биосовместимый полимер, функционирующий в качестве носителя или основы. Такие полимерные носители включают в себя, среди других форм, полимерные порошки, матрицы или средства доставки, представляющие собой микрочастицы. Полимер может быть растительного, животного или синтетического происхождения. Часто полимер является поперечно-сшитым. Дополнительно в этих системах доставки пептид, связывающийся с Y2-рецепторами, аналог или миметик, можно снабдить функциональной группировкой таким образом, что он может быть ковалентно связанным с полимером и стать неотделимым от полимера при простой промывке. В других вариантах осуществления полимер химически модифицируют ингибитором ферментов или других агентов, которые могут разлагать или инактивировать биологически активный(е) агент(ы) и(или) агент(ы), способствующий(е) доставке. В определенных препаратах полимер является частично или полностью нерастворимым в воде, но набухающим в воде полимером, например гидрогелем. Полимеры, полезные в этом аспекте настоящего изобретения, желательно являются взаимодействующими с водой и/или гидрофильными по природе для абсорбции значительных количеств воды,и они часто образуют гидрогели, когда их помещают в контакт с водой или водной средой в течение периода времени, достаточного для достижения равновесия с водой. В более детальных вариантах осуществления полимер является гидрогелем, который при контакте с избытком воды абсорбирует, по меньшей мере, двукратную по его массе массу воды при равновесии, при взаимодействии при комнатной температуре (патент США 6004583). Системы доставки лекарственного средства, основанные на биоразлагаемых полимерах, являются предпочтительными во многих биомедицинских приложениях из-за того, что такие системы разрушаются либо гидролизом, либо энзиматической реакцией на нетоксичные молекулы. Скорость деградации контролируют манипулированием составом биоразлагаемого полимерного матрикса. Поэтому эти типы систем можно использовать в определенных условиях для длительного высвобождения биологически активных агентов. Биоразлагаемые полимеры, такие как поли(гликолевая кислота) (PGA), поли(молочная кислота) (PLA) и сополи(D,L-молочная гликолевая кислота) (PLGA), привлекли значительное внимание как возможные средства доставки лекарственного средства, поскольку обнаружено, что продукты деградации этих полимеров имеют низкую токсичность. При нормальных метаболических функциях организма эти полимеры разлагаются в диоксид углерода и воду. Эти полимеры также проявляют прекрасную биосовместимость. Для продления биологической активности пептида, связывающегося с Y2-рецепторами, его аналогов и миметиков и других биологически активных агентов, описанные здесь, а также возможных агентов,способствующих доставке, эти агенты можно включать в полимерные матрицы, например полиортоэфиры, полиангидриды или полиэфиры. Это дает постоянную активность и высвобождение активного(ых) агента(ов), например, как определяют по деградации полимерной матрицы. Хотя инкапсулирование биотерапевтических молекул внутри синтетических полимеров может стабилизировать их во время хранения и доставки, главным препятствием в технологии высвобождения на основе полимера является потеря активности терапевтических молекул при процессах составления препарата, которые часто включают в себя обработку теплом, ультразвуком или органическими растворителями. Способствующие абсорбции полимеры, подразумеваемые для применения по этому изобретению,могут включать в себя производные и химически или физически модифицированные версии вышеуказанных типов полимеров, вдобавок к другим встречающимся в природе или синтетическим полимерам,гумми, смолам и другим агентам, а также смеси этих материалов одного с другим или с другими полимерами, постольку поскольку эти изменения, модификации или смешивание не оказывают нежелательного влияния на желаемые свойства, такие как абсорбция воды, образование гидрогеля и/или химическая стабильность для полезного применения. В более детальных аспектах этого изобретения такие полимеры, как нейлон, акрилан и другие в норме гидрофобные синтетические полимеры, можно в достаточной степени модифицировать взаимодействием так, что они становятся набухающими в воде и/или образуют стабильные гели в водной среде. Способствующие абсорбции полимеры по этому изобретению могут включать в себя полимеры из группы гомо- и сополимеров, основанных на различных комбинациях нижеследующих виниловых мономеров: акриловая и метакриловая кислоты, акриламид, метакриламид, гидроксиэтилакрилат или метакрилат, винилпирролидоны, а также поливиниловый спирт и его со- и терполимеры, поливинилацетат,его со- и терполимеры с вышеперечисленными мономерами и 2-акриламидо-2-метилпропансульфоновая кислота (AMPS). Очень полезными являются сополимеры вышеперечисленных мономеров с сополимеризуемыми функциональными мономерами, такими как акрил или метакриламидакрилат или метакрилатные эфиры, в которых эфирные группы являются производными алкила с прямой или разветвленной цепью, арила, имеющего до четырех ароматических колец, которые могут содержат алкильные заместители атомов углерода числом от 1 до 6; стероиды, сульфаты, фосфаты или катионные мономеры, такие как N,N-диметиламиноалкил(мет)акриламид, диметиламиноалкил(мет)акрилат, (мет)акрилоксиалкилтриметиламмония хлорид, (мет)акрилоксиалкилдиметилбензиламмония хлорид.- 26008829 Дополнительными способствующими абсорбции полимерами для применения по этому изобретению являются те, которые классифицируют как декстраны, декстрины, и класс материалов, которые классифицируют как натуральные гумми и смолы, или из класса натуральных полимеров, таких как процессированный коллаген, хитин, хитозан, пуллалан, зооглан, алгинаты и модифицированные алгинаты,такие как "Kelcoloid" (полипропиленгликоль, модифицированный алгинат), геллановые гумми, такие как"Kelocogel", ксантановые гумми, такие как "Keltrol", эстастин, альфа-гидроксибутират и его сополимеры,гиалуроновая кислота и ее производные, полимолочная и гликолевая кислоты. Очень полезным классом полимеров, применимых по этому изобретению, являются олефиновым образом ненасыщенные карбоновые кислоты, содержащие по меньшей мере одну активированную олефиновую двойную углерод-углеродную связь и по меньшей мере одну карбоксильную группу, то есть,кислотную или функциональную группу, легко превращаемую в кислоту, содержащую олефиновую двойную связь, которая легко функционирует в полимеризации из-за ее присутствия в мономерной молекуле либо в альфа- или бета-позиции относительно карбоксильной группы, либо в виде части концевой метиленовой группировки. Олефиновым образом ненасыщенные кислоты этого класса включают в себя такие материалы, как акриловые кислоты, типичными представителями которых являются сама акриловая кислота, альфа-цианоакриловая кислота, бета-метилакриловая кислота (кротоновая кислота), альфафенилакриловая кислота, бета-акрилоксипропионовая кислота, циннамовая кислота, р-хлорциннамовая кислота, 1-карбокси-4-фенилбутадиен-1,3-итаконовая кислота, цитраконовая кислота, мезаконовая кислота, глутаконовая кислота, аконтовая кислота, малеиновая кислота, фумаровая кислота и трикарбоксиэтилен. В данном контексте термин "карбоновая кислота" включает в себя поликарбоновые кислоты и те ангидриды кислоты, такие как малеиновый ангидрид, где ангидридная группа образована элиминацией одной молекулы воды из двух карбоксильных групп, находящихся на одной и той же молекуле карбоновой кислоты. Представители акрилатов, полезных в качестве способствующих абсорбции агентов по этому изобретению, включают в себя метилакрилат, этилакрилат, пропилакрилат, изопропилакрилат, бутилакрилат, изобутилакрилат, метилметакрилат, метилэтакрилат, этилметакрилат, октилакрилат, гептилакрилат,октилметакрилат, изопропилметакрилат, 2-этилгексилметакрилат, нонилакрилат, гексилакрилат, нгексилметакрилат и тому подобные. Акриловыми эфирами высшего алкила являются децилакрилат, изодецилметакрилат, лаурилакрилат, стеарилакрилат, бегенилакрилат и мезилилакрилат и их метакрилатные версии. Смеси двойных или тройных или более длинноцепочечных акриловых эфиров можно успешно полимеризовать с одним из карбоксильных мономеров. Другие сомономеры включают в себя олефины, в том числе альфа-олефины, виниловые простые эфиры, виниловые сложные эфиры и их смеси. Другие винилиденовые мономеры, в том числе акриловые нитрилы, также можно использовать в качестве способствующих абсорбции агентов в способах и композициях по этому изобретению для способствования доставке и абсорбции одного или нескольких из белков, аналогов и миметиков пептида,связывающегося с Y2-рецепторами, и других биологически активных агентов, что включает в себя способствование доставке активного(ых) агента(ов) в целевую ткань или компартмент в субъекте (например,печень, портальная вена печени, ткань или жидкость ЦНС, или плазма крови). Полезными альфа, бетаолефиновым образом ненасыщенными нитрилами являются предпочтительно моноолефиновым образом ненасыщенные нитрилы, имеющие от 3 до 10 атомов углерода, такие как акрилонитрил, метакрилонитрил и тому подобные. Наиболее предпочтительными являются акрилонитрил и метакрилонитрил. Также можно использовать акриловые амиды, содержащие от 3 до 35 атомов углерода, в том числе моноолефиновым образом ненасыщенные амиды. Представители амидов включают в себя акриламид, метакриламид, N-трет-бутилакриламид, N-циклогексилакриламид, амиды высших алкилов, в которых алкильная группа на азоте содержит от 8 до 32 атомов углерода, акриловые амиды, включающие в себя Nалкилоламиды альфа-, бета-олефиновым образом ненасыщенных карбоновых кислот, в том числе тех,которые имеют от 4 до 10 атомов углерода, такие как N-метилолакриламид, N-пропанолакриламид, Nметилолметакриламид, N-метилолмалеимид, сложный эфиры N-метилолмалеамовой кислоты, Nметилол-пара-винил бензамид и тому подобные. Другими полезными дополнительными материалами, способствующими абсорбции, являются альфа-олефины, содержащие от 2 до 18 атомов углерода, более предпочтительно от 2 до 8 атомов углерода; диены, содержащие от 4 до 10 атомов углерода; сложные виниловые эфиры и аллиловые сложные эфиры, такие как винилацетат; эфиры винила с ароматическим соединением, таким как стирол, метилстирол и хлорстирол; виниловые и аллиловые простые эфиры и кетоны, такие как винилметиловый простой эфир и метилвинилкетон; хлоракрилаты; цианоалкилакрилаты, такие как альфа-цианометилакрилат, и альфа-, бета- и гамма-цианопропилакрилаты; алкоксиакрилаты, такие как метоксиэтилакрилат; галогеноакрилаты, такие как хлорэтилакрилат; винилгалогениды и винилхлорид, винилиденхлорид и тому подобные; дивинилы, диакрилаты и другие полифункциональные мономеры, такие как дивиниловый простой эфир, диэтиленгликольдиакрилат, этиленгликольдиметакрилат, метилен-бис-акриламид, аллилпентаэритритол и тому подобные; и бис(бета-галогеноалкил)алкенилфосфонаты, такие как бис(бетахлорэтил)винилфосфонат и тому подобные, в той степени, насколько известно специалистам. Сополиме- 27008829 ры, в которых карбоксисодержащий мономер является минорной составной частью, и другие винилиденовые мономеры, присутствующие в качестве главных компонентов, легко получать в соответствии со способами, которые здесь раскрыты. Когда в качестве агентов, способствующих абсорбции, по этому изобретению используют гидрогели, их можно получать из синтетических сополимеров из группы акриловых и метакриловых кислот,акриламида, метакриламида, гидроксиэтилакрилата (НЕА) или метакрилата (НЕМА) и винилпирролидонов, которые являются взаимодействующими с водой и набухающими. Конкретными иллюстративными примерами полезных полимеров, особенно для доставки пептидов или белков, являются нижеследующие типы полимеров: (мет)акриламид и (мет)акриловая кислота от 0,1 до 99 мас.%; (мет)акриламиды и(торговая марка Lubrizol Corp.) от 0,1 до 75% мас.%; (мет)акриламид и алкил(мет)акриламиды от 0 до 30 мас.% и AMPS.RTM от 0,1 до 75 мас.%; (мет)акриламид и НЕМА от 0,1 до 99 мас.%; (мет)акриламид и НЕМА от 0,1 до 75 мас.% и (мет)акриловая кислота от 0,1 до 99%; (мет)акриловая кислота и НЕМА от 0,1 до 99 мас.%; 50 моль-% винилового простого эфира и 50 моль-% малеинового ангидрида;(мет)акриламид и от 0,1 до 99 мас.% винилпирролидона; (мет)акриламид и 50 мас.% винилпирролидона и от 0,1 до 99,9 мас.% (мет)акриловой кислоты; (мет)акриловая кислота и 0,1-75 мас.% AMPS.RTM; и 0,1-75 мас.% алкил(мет)акриламид. В вышеуказанных примерах алкил означает линейный и разветвленный от C1 до С 30, предпочтительно от С 1 до С 22, и циклический от С 4 до С 16; термин (мет) означает, что охватываются мономеры с метильной группой и без метильной группы. Другими очень полезными полимерами, представляющими собой гидрогели, являются набухающие, но нерастворимые версии поли(винилпирролидон)ового крахмала, карбоксиметилцеллюлозы и поливинилового спирта. Дополнительные полимерные материалы, представляющие собой гидрогели, полезные по этому изобретению, включают в себя (поли)гидроксиалкил(мет)акрилат; анионные и катионные гидрогели; полиэлектролитные комплексы; поли(виниловые спирты) имеющие низкий остаточный ацетат; набухающая смесь перекрестно сшитого агара и перекрестно-сшитой карбоксиметилцеллюлозы: набухающая композиция, содержащая метилцеллюлозу, смешанную со слабо поперечно-сшитым агаром; набухающий в воде сополимер, получаемый диспергированием тонкоизмельченного сополимера малеинового ангидрида со стиролом, этиленом, пропиленом или изобутиленом; набухающий в воде полимер Nвиниллактамов; набухающие натриевые соли карбоксиметилцеллюлозы и тому подобное. Другие гелеобразующие пропитываемые жидкостью и удерживающие жидкость полимеры, полезные для образования гидрофильных гидрогелей для доставки через слизистые биологически активных агентов по этому изобретению, включают в себя пектин; полисахариды, такие как агар, гуммиарабик,карайя, трагакант, алгины и гуар и их поперечно-сшитые версии; производные акриловой кислоты, представляющие собой полимеры, сополимеры и соль, полиакриламиды; набухающие в воде полимеры инденмалеинового ангидрида; сополимеры с привитым крахмалом; полимеры и сополимеры акрилатного типа со способностью абсорбировать воду в количестве от около двукратного до в 400 раз большего, чем их исходная масса; диэфиры полиглюкана; смесь поперечно-сшитого полимера винилового спирта и полимера N-винил-2-пирролидона; гели, представляющие собой блочный полиоксибутиленполиэтилновый сополимер, гумми цератонии, гели, представляющие собой полимеры простых эфиров; полимочевинные гели; гели, представляющие собой полимеры простых эфиров; полиамидные гели; полиимидные гели; полипептидные гели; полиаминокислотные гели; полицеллюлозные гели; поперечносвязанные полимеры инденмалеинового ангидрида и акрилата; и полисахариды. Синтетические полимеры, представляющие собой гидрогель, для применения по этому изобретению можно получать бесчисленными комбинациями нескольких мономеров в нескольких соотношениях. Гидрогель может быть поперечно-сшитым и обычно обладает способностью впитывать и абсорбировать жидкость и набухать или расширяться до расширенного равновесного состояния. Гидрогель в типичных случаях разбухает или расширяется при доставке на слизистую поверхность носовой полости, абсорбируя массу воды, которая примерно в 2-5, в 5-10, в 10-50, до 50-100 раз и в большее число раз больше его собственной массы. Оптимальная степень набухающей способности для данного гидрогеля должна быть определена для разных биологически активных агентов в зависимости от таких факторов, как молекулярная масса, размер, характеристики растворимости и диффузии активного агента, переносимого или заключенного или инкапсулированного в этом полимере, и конкретных промежутков между цепями и их кооперативной подвижностью в каждом индивидуальном полимере. Гидрофильные полимеры, полезные по этому изобретению, являются нерастворимыми в воде, но набухающими в воде. Такие набухающие в воде полимеры обычно называют гидрогелями или гелями. Такие гели можно удобно получать из водорастворимых полимеров способом поперечного сшивания этих полимеров подходящим агентом поперечного сшивания. Однако стабильные гидрогели можно также формировать из конкретных полимеров в определенных условиях рН, температуры и/или концентрации ионов в соответствии со способами, известными в данной области. В типичных случаях полимеры являются поперечно-сшитыми, то есть поперечно-сшитыми до степени, в которой эти полимеры облада- 28008829 ют хорошими гидрофильными свойствами, имеют улучшенную физическую целостность (при сравнении с не поперечно-сшитыми полимерами того же типа) и проявляют улучшенную способность удерживать в пределах сетчатой структуры геля как биологически активный агент, представляющий интерес, так и дополнительные соединения для совместного введения с ним, такие как ингибитор цитокина или фермента, в то же время сохраняя способность высвобождения активного агента(ов) в надлежащем месте и в нужное время. Обычно полимеры, представляющие собой гидрогель, для применения по этому изобретению являются поперечно-сшитыми с дифункциональными поперечными сшивками при количестве агента поперечного сшивания от 0,01 до 25 мас.% на основании массы мономеров, образующих этот сополимер, и более предпочтительно от 0,1 до 20 мас.% и более часто от 0,1 до 15 мас.% Другим полезным количеством агента поперечного сшивания является от 0,1 до 10 мас.%. Можно также использовать агенты поперечного сшивания, имеющие три-, тетра или более высокую степень мультифункциональности. При использовании таких реагентов меньшие количества могут требоваться для достижения эквивалентной плотности поперечного сшивания, то есть степени поперечного сшивания или свойств сетчатой структуры, которые являются достаточными для эффективного содержания биологически активного(ых) агента(ов). Поперечные сшивки могут быть ковалентными, ионными или водородными связями с полимером,обладающим способностью набухать в присутствии жидкостей, содержащих воду. Такие поперечные сшиватели и поперечно-сшивающие взаимодействия известны специалистам в данной области и во многих случаях являются зависимыми от полимерной системы. Таким образом, сетчатую структуру поперечных сшивок можно формировать свободнорадикальной сополимеризацией ненасыщенных мономеров. Полимерные гидрогели можно также формировать поперечным сшиванием предварительно сформированных полимеров взаимодействием с функциональными группами, находящимися на этих полимерах, такими как спирты, кислоты, амины, с такими группами, как глиоксаль, формальдегид или глутаральдегид, бис-ангидриды и тому подобные. Полимеры также можно поперечно сшивать любым полиеном, например декадиеном или тривинилциклогексаном; акриламидами, такими как N,N-метилен-бис (акриламид); полифункциональными акрилатами, такими как триметилолпропантриакрилат; или полифункциональными винилиденовыми мономерами, содержащими по меньшей мере 2 концевые группы СН 2, в том числе, например, дивинилбензолом, дивинилнафталином, аллилакрилатами и тому подобным. В определенных вариантах осуществления поперечно-сшивающими мономерами для применения в получении сополимеров являются полиалкениловые полиэфиры, имеющие более чем одну из алкенильных эфирных группировок на молекулу, которые возможно могут содержать алкенильные группы, в которых присутствует олефиновая двойная связь при концевой метиленовой группировке (например, полученные этерификаций многоатомного спирта, содержащего по меньшей мере 2 атома углерода и по меньшей мере 2 гидроксильные группы). Соединения этого класса можно получать взаимодействием алкенилгалогенида, такого как аллилхлорид или аллилбромид, с сильно щелочным водным раствором одного или нескольких из полиатомных спиртов. Этот продукт может быть также комплексной смесью полимеров простых эфиров с варьирующими числами групп, представляющих собой простой эфир. Эффективность агента поперечного сшивания образованием простых эфиров увеличивается с числом потенциально полимеризуемых групп на молекуле. В типичных случаях используют полиэфиры, содержащие в среднем две или более чем две эфирные группы с алкенилом на молекулу. Другие поперечно-сшитые мономеры включают в себя, например, диаллиловые сложные эфиры, диметаллиловые простые эфиры, аллил- или металлилакрилаты и акриламиды, тетравинилсилан, полиалкенилметаны, диакрилаты и диметакрилаты, дивинильные соединения, такие как дивинилбензол, полиаллилфосфат, диаллилоксисоединения и фосфитовые сложные эфиры и тому подобные. Типичными агентами являются аллилпентаэритритол, аллилсахароза, триметилолпропантриакрилат, 1,6-гександиолдиакрилат, триметилолпропандиаллиловый простой эфир, пентаэритритолтриакрилат, тетраметилендиметакрилат, этилендиакрилат, этилендиметакрилат, триэтиленгликольдиметакрилат и тому подобные. Аллилпентаэритритол, триметилолпропандиаллилпростой эфир и аллилсахароза дают подходящие полимеры. При наличии агента поперечного сшивания полимерные смеси обычно содержат приблизительно от 0,01 до 20 мас.%, например, 1, 5, или 10 или более чем 10 мас.% поперечносшивающего мономера по сумме мономера, являющегося карбоновой кислотой, и других мономеров. В более детальных аспектах этого изобретения доставке, осуществляемой через слизистые оболочки, пептида, связывающегося с Y2-рецепторами, аналогов и миметиков и других биологически активных агентов, которые здесь раскрыты, способствуют удержанием активного(ых) агента(ов) в носителе для медленного высвобождения или ферментатически или физиологически защитном носителе, например гидрогеле, который экранирует активный агент от действия разлагающих ферментов. В определенных вариантах осуществления активный агент связывают химическими способами с носителем или средством доставки, с которым можно также смешать или связать дополнительные агенты, такие как ингибиторы фермента, цитокины и т.д. Или же активный агент можно иммобилизовать достаточным физическим заключением в носителе или средстве доставки, например полимерном матриксе.- 29008829 Полимеры, такие как гидрогели, полезные по этому изобретению, могут включать функциональные связанные агенты, такие как гликозиды, химически включенные в полимер для способствования биологической доступности смешанных с ними активных агентов при введении через нос. Примерами таких гликозидов являются глюкозиды, фруктозиды, галактозиды, арабинозиды, маннозиды и их алкилзамещенные производные и натуральные гликозиды, такие как арбутин, флоризин, амигдалин, дигитонин,сапонин и инидикан. Есть несколько путей, которыми типичный гликозид можно связать с полимером. Например, водород гидроксильных групп гликозида или другого похожего углеводорода можно заменять алкильной группой из полимера гидрогеля с образованием простого эфира. Также можно проводить взаимодействие гидроксильных групп гликозидов с карбоксильными группами сложных эфиров в полимерном гидрогеле с образованием полимерных сложных эфиров in situ. Другим подходом является использование конденсации ацетобромглюкозы с холест-5-ен-3 бета-олом на сополимере малеиновой кислоты. N-замещенные полиакриламиды можно синтезировать взаимодействием активированных полимеров с омега-аминоалкилгликозидами: (1) (углеводород-спэйсер)(n)-полиакриламид, псевдополисахариды; (2) (углеводород спейсер)(n)-фосфатидилэтаноламин(m)-полиакриламид, неогликолипиды, производные фосфатидилэтаноламина; (3) (углеводород-спейсер)(m)-биотин(m)-полиакриламид. Эти биотинилированные производные могут прикрепляться к лектинам на слизистой поверхности для облегчения абсорбции биологически активного(ых) агента(ов), например инкапсулированного в полимер пептида,связывающегося с Y2-рецепторами. В более детальных аспектах этого изобретения один или несколько пептидов, связывающихся с Y2 рецепторами, их аналогов и миметиков и/или других биологически активный агентов, описанных здесь,возможно, включающие в себя активные вторичные агенты, такие как ингибитор(ы) протеазы, цитокин(ы), дополнительный(е) модулятор(ы) физиологии межклеточных стыков и т.д., модифицируют и связывают с полимерным носителем или матриксом. Например, это можно осуществлять химическим связыванием активного агента, представляющего собой пептид или белок, и другого(их) возможного(ых) агента(ов) в пределах сетчатой структуры поперечно-сшитого полимера. Также возможно химически модифицировать полимер отдельно взаимодействующим агентом, таким как молекула, содержащая гликозидаль. В определенных аспектах биологически активный(е) агент(ы) и возможно вторичный(е) активный(е) агент(ы) можно функционализировать, то есть к активному(ым) агенту(ам) химически присоединить или идентифицировать на нем надлежащую активную группу. Наиболее часто присоединяют этиленовую полимеризуемую группу, и затем функционализированный активный агент сополимеризуют с мономерами и агентом поперечного сшивания при использовании стандартного способа полимеризации,такого как полимеризация в растворе (обычно в воде), эмульсии, суспензии или дисперсии. Часто функционализирующий агент используют при достаточно высокой концентрации функциональных или полимеризуемых групп, чтобы гарантировать то, что несколько точек на активном(ых) агенте(ах) являются функционализированными. Например, в полипептиде, содержащем 16 точек, представляющих собой амин, обычно желательно функционализировать по меньшей мере 2, 4, 5, 7 и до 8 или более этих точек. После функционализации функциональный(е) активный(е) агент(ы) смешивают с мономерами и поперечно-сшивающим агентом, который содержит реагенты, из которых образуется полимер, представляющий интерес. Затем индуцируют полимеризацию в этой среде для создания полимера, содержащего связанный(е) активный(е) агент(ы). Этот полимер затем промывают водой или другими надлежащими растворителями и иным образом очищают для удаления следов непрореагировавших примесей и, если необходимо, перемалывают или измельчают физическими способами, такими как перемешивание, продавливание через сетку, обработка ультразвуком или другими способами, подходящими для желаемого размера частиц. Растворитель, обычно воду, затем удаляют таким образом, чтобы не денатурировать или иным образом не разрушить активный(е) агент(ы). Предпочтительным способом является лиофилизация(сублимационная сушка), но есть и другие способы, которые можно использовать (например, вакуумную сушку, воздушную сушку, распылительную сушку и т.д.). Для введения полимеризуемых групп в пептиды, белки и другие активные агенты по этому изобретению можно проводить взаимодействие доступных аминных, гидроксильных, тиольных и других активных групп с электрофилами, содержащими ненасыщенные группы. Например, к этой категории реагентов принадлежат ненасыщенные мономеры, содержащие N-гидроксисукцинимидильные группы, активные карбонаты, такие как р-нитрофенилкарбонат, трихлорфенилкарбонаты, трезилат, оксикарбонилимидазолы, эпоксид, изоцианаты и альдегид и ненасыщенные карбоксиметилазиды и ненасыщенный ортопиридилдисульфид. Показательными примерами ненасыщенных реагентов являются аллилглицидиловый простой эфир, аллилхлорид, аллилбромид, аллилйодид, акрилоилхлорид, аллилизоцианат, аллилсульфонилхлорид, малеиновый ангидрид, сополимеры малеинового ангидрида и аллильного простого эфира и тому подобные. Все производные, активные по отношению к лизину, кроме альдегида, могут обычно взаимодействовать с другими аминокислотами, такими как имидазольные группы гистидина и гидроксильные группы тирозина и тиольные группы цистеина, если локальная среда способствует нуклеофильности этих групп. Альдегидсодержащие функционализирующие реагенты являются специфичными по отношению к

МПК / Метки

МПК: A61K 38/00, A61P 43/00

Метки: композиции, y2-рецепторами, связывающихся, усовершенствованной, предотвращения, способы, оболочки, слизистые, пептидов, ожирения, доставки, осуществляют, лечения, которую

Код ссылки

<a href="http://easpatents.com/30-8829-kompozicii-i-sposoby-dlya-usovershenstvovannojj-dostavki-peptidov-svyazyvayushhihsya-s-y2-receptorami-kotoruyu-osushhestvlyayut-cherez-slizistye-obolochki-i-sposoby-lecheniya-i-pre.html" rel="bookmark" title="База патентов Евразийского Союза">Композиции и способы для усовершенствованной доставки пептидов, связывающихся с y2-рецепторами, которую осуществляют через слизистые оболочки, и способы лечения и предотвращения ожирения</a>

Похожие патенты