Композиции и способы контроля специфичности передачи сигналов, опосредуемой тканевым фактором

Есть еще 22 страницы.

Смотреть все страницы или скачать PDF файл.

Формула / Реферат

1. Способ ингибирования или подавления передачи сигнала через тканевый фактор/фактор VIIa (TF/VIIa) с участием активируемого протеиназами рецептора -2 (PAR2) у субъекта, относящегося к млекопитающим, включающий введение ингибитора передачи сигнала через тканевый фактор субъекту, относящемуся к млекопитающим, при этом ингибитор не нарушает гемостаз у указанного субъекта.

2. Способ по п.1, отличающийся тем, что указанный субъект страдает связанным с ангиогенезом заболеванием, неопластическим заболеванием или воспалением.

3. Способ по п.1, отличающийся тем, что указанный ингибитор не предотвращает активацию свертывания.

4. Способ по п.1, отличающийся тем, что передача сигнала через TF/VIIa зависит от белка дисульфидизомеразы (PDI).

5. Способ по п.1, отличающийся тем, что передача сигнала через TF/VIIa происходит через активируемый протеазами рецептор 2 (PAR2).

6. Способ по п.1, отличающийся тем, что указанный ингибитор представляет собой антитело или низкомолекулярное соединение.

7. Способ по п.6, отличающийся тем, что указанный ингибитор представляет собой антитело или антигенсвязывающую молекулу, обладающую специфичностью связывания, как у моноклонального антитела 10Н10, продуцируемого гибридомой с номером доступа АТСС НВ9383.

8. Способ по п.6, отличающийся тем, что указанный ингибитор представляет собой моноклональное антитело 10H10, продуцируемое гибридомой с номером доступа АТСС НВ9383.

9. Способ по п.1, отличающийся тем, что указанный ингибитор ингибирует связывание тканевого фактора моноклональным антителом 10H10, продуцируемым гибридомой с номером доступа АТСС НВ9383.

10. Способ по п.1, отличающийся тем, что указанный ингибитор не ингибирует связывание с тканевым фактором моноклонального антитела 5G9, продуцируемого гибридомой с номером доступа АТСС НВ9382.

11. Способ лечения или снижения выраженности симптомов заболевания, которое зависит от передачи сигнала через тканевый фактор/фактор VIIa (TF/VIIa) с участием активируемого протеиназами рецептора 2 (PAR2), у субъекта, относящегося к млекопитающим, включающий введение субъекту терапевтически эффективного количества соединения, ингибирующего передачу сигнала через TF/VIIa, но не нарушающего опосредуемую тканевым фактором гомеостатическую активность.

12. Способ по п.11, отличающийся тем, что указанное заболевание представляет собой неопластическое заболевание, заболевание, связанное с ангиогенезом, или воспаление.

13. Способ по п.11, отличающийся тем, что указанное заболевание представляет собой опухоль груди или меланому.

14. Способ по п.11, отличающийся тем, что указанная гомеостатическая активность представляет собой опосредуемое TF свертывание крови.

15. Способ по п.11, отличающийся тем, что передача сигнала через TF/VIIa зависит от белка дисульфидизомеразы.

16. Способ по п.11, отличающийся тем, что передача сигнала через TF/VIIa происходит через активируемый протеазами рецептор 2 (PAR2).

17. Способ по п.11, отличающийся тем, что указанное соединение представляет собой антитело или низкомолекулярное соединение.

18. Способ по п.17, отличающийся тем, что указанное соединение представляет собой антитело или антигенсвязывающую молекулу, обладающую специфичностью связывания, как у моноклонального антитела 10Н10, продуцируемого гибридомой с номером доступа АТСС НВ9383.

19. Способ по п.17, отличающийся тем, что указанное соединение представляет собой моноклональное антитело 10H10, продуцируемое гибридомой с номером доступа АТСС НВ9383.

20. Способ идентификации агента, ингибирующего передачу сигнала через TF/VIIa с участием активируемого протеиназами рецептора 2 (PAR2), но не блокирующего свертывание крови, включающий измерение в присутствии и в отсутствие тестируемого соединения связывания (i) антитела или антигенсвязывающей молекулы, обладающей специфичностью связывания, как у моноклонального антитела 10H10, продуцируемого гибридомой с номером доступа АТСС НВ9383, с (ii) полипептидом тканевого фактора; и определение ингибирования указанного связывания в присутствии тестируемого соединения относительно связывания в отсутствие тестируемого соединения, что и позволяет идентифицировать указанный агент.

21. Способ по п.20, отличающийся тем, что указанное антитело или антигенсвязывающая молекула представляет собой моноклональное антитело, продуцируемое гибридомой с номером доступа АТСС НВ9383.

22. Способ по п.20, отличающийся тем, что указанное тестируемое соединение представляет собой низкомолекулярное органическое соединение.

23. Способ по п.20, включающий дополнительно определение ингибиторного действия идентифицированного агента на передачу сигнала через тканевый фактор.

24. Способ по п.20, включающий дополнительно определение отсутствия действия идентифицированного агента на опосредуемое тканевым фактором свертывание.

25. Способ по п.20, включающий дополнительно (i) осуществление контакта, в присутствии и в отсутствие идентифицированного агента, полипептида тканевого фактора с моноклональным антителом 5G9, продуцируемым гибридомой с номером доступа АТСС НВ9382, и (ii) определение отсутствия ингибирования указанным агентом связывания указанного антитела с тканевым фактором.

Текст

Смотреть все

КОМПОЗИЦИИ И СПОСОБЫ КОНТРОЛЯ СПЕЦИФИЧНОСТИ ПЕРЕДАЧИ СИГНАЛОВ, ОПОСРЕДУЕМОЙ ТКАНЕВЫМ ФАКТОРОМ(71)(73) Заявитель и патентовладелец: ЗЕ СКРИПС РЕСЕЧ ИНСТИТЬЮТ (US) Предложены композиции и способы лечения заболевания, зависящего от передачи сигнала через тканевый фактор/фактор VIIa, у субъекта, относящегося к млекопитающим. Указанные способы включают введение ингибитора передачи сигнала через тканевый фактор субъекту, относящемуся к млекопитающим. Указанный ингибитор эффективен в снижении числа новых случаев заболевания у субъекта, относящегося к млекопитающим. Также предложены способы скрининга для выявления модуляторов передачи сигнала через тканевый фактор/фактор VIIa. 014900 Ссылка на родственные заявки Настоящая заявка на патент испрашивает приоритет согласно предварительной заявке на патент США, серийный номер 60/734,149 (поданной 7 ноября, 2005). Описание приоритетной заявки полностью включено в данную заявку посредством ссылки для любых целей. Указание правительственной поддержки Настоящее изобретение было осуществлено при поддержке правительства в рамках грантовHL60472, HL31950, и HL16411 Национального института сердца, легких и крови. Правительство имеет определенные права на настоящее изобретение. Область изобретения Настоящее изобретение в целом относится к композициям и способам лечения заболевания, зависящего от передачи сигнала через тканевый фактор/фактор свертывания крови VIIa (TF/VIIa), у субъекта, относящегося к млекопитающим. Указанные способы включают введение субъекту, относящемуся к млекопитающим, ингибитора передачи сигналов через тканевый фактор. Указанный ингибитор эффективно снижает количество случаев заболевания или исключает их, или предотвращает возникновение или рецидив, не нарушая гемостаз у субъекта, относящегося к млекопитающим. Уровень техники Ферментативный комплекс рецептора клеточной поверхности - тканевого фактора (TF) - с сериновой протеазой, фактором VIIa, активирует физиологический гемостаз и сертывание крови и одновременно запускает активируемую протеазой передачу сигнала через рецептор при воспалении, прогрессировании опухоли и ангиогенезе. Mackman, Arterioscler. Thromb. Vasc. Biol. 24: 1015-1022, 2004; Riewald иRuf, Crit. Care 7: 123-129, 2003; Belting и др., Arterioscler. Thromb. Vasc. Biol. 25: 1545-1550, 2005). Каким образом предшествующие пути передачи сигнала напрямую через TF-VIIa определяют патологию, без подавления нарабатываемыми в большом количестве протеазами, участвующими в процессе свертывания крови, оставалось фундаментальным, неразрешенным вопросом биологии сосудов. Kawabata и др.,Br J. Pharmacol., 144: 212-219, 2005; Namkung, et al. Gastroenterology, 126: 1844-1859, 2004; Fiorucci и др.,Proc Natl Acad Sci USA, 98: 13936-13941, 2001; Cocks и др., Nature, 398: 156-160, 1999.TF связывает и аллостерическим образом активирует фактор VIIa и способствует сборке тройного инициирующего свертывание комплекса TF-VIIa-X, из которого высвобождается продукт Ха, что приводит к образованию тромбина. Norledge и др., Proteins 53: 640-648, 2003. Комплекс TF-VIIa также непосредственно расщепляет активируемый протеазами рецептор 2 (PAR2). Camerer и др., Proc. Natl. Acad.Sci. USA 97: 5255-5260, 2000; Riewald и Ruf, Proc. Natl. Acad, Sci. USA 98: 7742-7747, 2001. Несмотря на хорошо известную роль опосредованной тромбином передачи сигнала через рецепторы PAR в процессах гемостаза и воспаления, активация рецепторов PAR другими протеазами in vivo остается слабо изученной. Coughlin, J. Thromb. Haemost. 3: 1800-1814, 2005. TF и PAR2 поскольку фосфорилирование цитоплазматического домена TF происходит вслед за передачей сигналов через PAR2, и мыши, у которых удален цитоплазматический домен TF, проявляют усиленный PAR2-зависимый ангиогенез. Ahamed иRuf, J. Biol. Chem. 279: 23038-23044, 2004; Belting и др., Nature Med. 10: 502-509, 2004. Тем не менее, в настоящее время не совсем ясно, каким образом регулируется передача сигнала через TF-VIIa и каким образом он выполняет свои физиологические функции, независимуые от передачи сигнала на последующих этапах другими протеазами, вовлеченными в коагуляцию. На данный момент не существуют какихлибо ингибиторов ангиогенеза, одобренных Управлением по контролю за продуктами питания и лекарственными средствами США (FDA) для лечения связанных с ангиогенезом заболеваний. В данной области существует необходимость регулировать или ингибировать передачу сигналов через TF, связанную с ангиогенезом, ростом опухолевых клеток, метастазированием опухоли или воспалением, без влияния на нормальный процесс гемостаза. Краткое описание изобретения Настоящее изобретение относится, в общем, к композициям и способам лечения заболеваний у субъекта, относящегося к млекопитающим, например заболеваний, связанных с ангиогенезом, воспаления или неопластических заболеваний. Композиция представляет собой ингибитор передачи сигнала через тканевый фактор, который не нарушает гемостаз субъекта, относящегося к млекопитающим. Указанные способы включают введение ингибитора передачи сигналов через тканевый фактор субъекту,относящемуся к млекопитающим. Данный ингибитор эффективен для снижения количества случаев связанных с ангиогенезом болезненных состояний, воспаления или неопластических заболеваний и при этом не повышает риск ослабления свертываемости крови или усиленного кровотечения у субъекта, относящегося к млекопитающим. Предложен способ лечения заболевания, зависящего от передачи сигнала через тканевый фактор/фактор VIIa, у субъекта, относящегося к млекопитающим, включающий введение ингибитора передачи сигнала через тканевый фактор субъекту, относящемуся к млекопитающим, в количестве, эффективном для ослабления или устранения заболевания или предотвращения его возникновения или рецидива у субъекта, относящегося к млекопитающим, причем указанный ингибитор не нарушает гемостаз у субъекта, относящегося к млекопитающим. Указанные заболевания включают, без ограничения: связанное с ангиогенезом заболевание, неопластическое заболевание или воспаление. Неопластические заболе-1 014900 вания или воспаление включены в связанные с ангиогенезом заболевания. В одном аспекте указанный ингибитор представляет собой антитело или низкомолекулярное соединение. В частности, указанный ингибитор представляет собой моноклональное антитело 10 Н 10 (MAT 10H10), продуцируемое гибридомой с номером доступа в АТСС: НВ 9383. Предложен способ идентификации соединения, которое модулирует передачу сигнала через тканевый фактор вклетках, который включает этапы осуществления контакта тестируемого соединения с тестсистемой, на основе клеток, включающей клетку, экспрессирующую тканевый фактор, способный к передаче сигнала, причем зависиая от тканевого фактора передача сигнала регулируется белком дисульфидизомеразой, обеспечения указанной тест-системы фактором VIIa в количестве, выбранном таким образом, что оно является эффективным для активации зависящей от тканевого фактора передачи сигнала, и определение (детектирование) действия указанного тестируемого соединения на зависящую от тканевого фактора передачу сигнала в указанной тест-системе, при этом эффективность указанного тестируемого соединения в указанной тест-системе свидетельствует о модуляции. В одном аспекте способ дополнительно включает определение ингибиторного действия тестируемого соединения на передачу сигнала через тканевый фактор. В дополнительном аспекте указанный способ дополнительно включает определение отсутствия действия тестируемого соединения на опосредуемый тканевым фактором гемостаз. Указанные клетки включают, без ограничения, кератиноциты, клетки меланомы или эндотелия. В дополнительном аспекте указанная клеточная тест-система вызывает ответ через активируемый протеазами рецептор 2. В дополнительном аспекте указанное тестируемое соединение представляет собой антитело или малую молекулу. В частности, указанное соединение ингибирует связывание MAT 10H10 с тканевым фактором. В дополнительном частном аспекте указанное соединение не ингибирует связывание моноклонального антитела 5G9 (MAT 5G9), продуцируемого гибридомой с номером доступа АТСС: НВ 9382, с тканевым фактором. Предложен способ лечения ангиогенеза у субъекта, относящегося к млекопитающим, включающий введение терапевтически эффективного количества соединения, которое модулирует передачу сигнала в клетках через путь с участием тканевого фактора-фактора VIIa, отличающийся тем, что указанное соединение является антагонистом передачи сигнала через тканевый фактор-фактор VIIa в клеточной тестсистеме, и указанное соединение эффективно для снижения уровня или устранения ангиогенеза или предотвращения его возникновения или рецидива у субъекта, относящегося к млекопитающим. В дополнительном аспекте указанное соединение не нарушает гемостаз у субъекта, относящегося к млекопитающим. В одном аспекте передача сигнала через тканевый фактор-фактор VIIa зависит от белка дисульфидизомеразы. В другом аспекте передача сигнала через тканевый фактор-фактор VIIa происходит через активируемый протеазами рецептор 2. В дополнительном аспекте указанное тестируемое соединение представляет собой антитело или малую молекулу. В частности, указанное соединение ингибирует связывание MAT 10H10 с тканевым фактором. В дополнительном частном аспекте указанное соединение не ингибирует связывание MAT 5G9 с тканевым фактором. Предложен способ лечения неопластического заболевания у субъекта, относящегося к млекопитающим, включающий введение терапевтически эффективного количества соединения, которое модулирует передачу сигнала в клетках через путь с участием тканевого фактора-фактора VIIa, отличающийся тем, что указанное соединение действует как антагонист передачи сигнала через тканевый факторфактор VIIa в клеточной тест-системе, и указанное соединение эффективно для снижения уровня или устранения неопластического заболевания или предотвращения его возникновения или рецидива у субъекта, относящегося к млекопитающим. В дополнительном аспекте указанное соединение не нарушает гемостаз у субъекта, относящегося к млекопитающим. В одном аспекте передача сигнала через тканевый фактор-фактор VIIa зависит от белка дисульфидизомеразы. В другом аспекте передача сигнала через тканевый фактор-фактор VIIa происходит через активируемый протеазами рецептор 2. В дополнительном аспекте указанное тестируемое соединение представляет собой антитело или малую молекулу. В частности, указанное соединение ингибирует связывание MAT 10 Н 10 с тканевым фактором. В дополнительном частном аспекте указанное соединение не ингибирует связывание MAT 5G9 с тканевым фактором. Предложен способ лечения воспаления у субъекта, относящегося к млекопитающим, включающий введение терапевтически эффективного количества соединения, которое модулирует передачу сигнала в клетках через путь с участием тканевого фактора-фактора VIIa, отличающийся тем, что указанное соединение действует как антагонист передачи сигнала через тканевый фактор-фактор VIIa в клеточной тестсистеме и указанное соединение эффективно для снижения выраженности или устранения заболевания или предотвращения его возникновения или рецидива у субъекта, относящегося к млекопитающим. В дополнительном аспекте указанное соединение не нарушает гемостаз у субъекта, относящегося к млекопитающим. В одном аспекте передача сигнала через тканевый фактор-фактор VIIa зависит от белка дисульфидизомеразы. В другом аспекте передача сигнала через тканевый фактор-фактор VIIa происходит через активируемый протеазами рецептор 2. В дополнительном аспекте указанное тестируемое соединение представляет собой антитело или низкомолекулярное соединение. В частном аспекте указанное соединение ингибирует связывание MAT 10H10 с тканевым фактором. В дополнительном частном аспекте-2 014900 указанное соединение не ингибирует связывание MAT 5G9 с тканевым фактором. Предложен способ выявления наличия или предрасположенности к связанному с ангиогенезом болезненному состоянию у субъекта, относящегося к млекопитающим, включающий взятие образца у субъекта, относящегося к млекопитающим; введение антитела, которое иммуноспецифичным образом связывается с тканевым фактором в образце, и определение присутствия или количества антитела, связанного с тканевым фактором в образце, при этом наличие антитела, связанного с тканевым фактором,свидетельствует о наличии или предрасположенности к связанному с ангиогенезом болезненному состоянию у субъекта, относящегося к млекопитающим, причем указанное антитело ингибирует передачу сигнала через тканевый фактор и не нарушает гемостаз у субъекта, относящегося к млекопитающим. В дополнительном аспекте указанного способа повышенный уровень антитела, связанного с тканевым фактором, указывает на наличие или предрасположенность к связанному с ангиогенезом болезненному состоянию. В частности, указанное антитело представляет собой MAT 10H10. В дополнительном частном аспекте указанное связанное с ангиогенезом болезненное состояние представляет собой неопластическое заболевание или воспаление. Предложен способ выявления наличия или предрасположенности к неопластическому болезненному состоянию у субъекта, относящегося к млекопитающим, включающий взятие образца у субъекта, относящегося к млекопитающим, введение антитела, которое иммуноспецифичным образом связывается с тканевым фактором в образце, и определение присутствия или количества антитела, связанного с тканевым фактором в образце, при этом наличие антитела, связанного с тканевым фактором, свидетельствует о наличии или предрасположенности к неопластическому заболеванию у субъекта, относящегося к млекопитающим, причем указанное антитело ингибирует передачу сигнала через тканевый фактор и не нарушает гемостаз у субъекта, относящегося к млекопитающим. В дополнительном аспекте указанного способа повышенный уровень антитела, связанного с тканевым фактором, указывает на наличие или предрасположенность к неопластическому болезненному состоянию. В частности, указанное антитело представляет собой MAT 10H10. В частности, указанное неопластическое болезненное состояние представляет собой солидную опухоль, доброкачественную или злокачественную раковую опухоль молочной железы, меланому, глиому, астроцитому, гематологическое злокачественное новообразование, лейкемию, рак легких, колоректальный рак, рак матки, лейомиому матки, рак яичников, рак эндометрия, синдром поликистоза яичников, полипы эндометрия, рак предстательной железы, гипертрофию предстательной железы, рак слизистой, аденомиоз, аденокарциному, менингиому, рак кости, множественную миелому, или рак центральной нервной системы. Предложен способ выявления наличия или предрасположенности к воспалительному заболеванию у субъекта, относящегося к млекопитающим, включающий взятие образца у субъекта, относящегося к млекопитающим; введение антитела, которое иммуноспецифично связывается с тканевым фактором в образце; и установление наличия или количества антитела, связанного с тканевым фактором в образце,отличающийся тем, что наличие антитела, связанного с тканевым фактором, свидетельствует о наличии или предрасположенности к воспалительному заболеванию у субъекта, относящегося к млекопитающим,при этом указанное антитело ингибирует передачу сигнала через тканевый фактор и не нарушает гемостаз у субъекта, относящегося к млекопитающим. В дополнительном аспекте указанного способа повышенный уровень антитела, связанного с тканевым фактором, указывает на наличие или предрасположенность к воспалительному болезненному состоянию. В частности, указанное антитело представляет собойMAT 10H10. Краткое описание чертежей На фиг. 1 показано специфичное ингибирование передачи сигнала через тканевый фактор; на фиг. 2 показано, что передача сигнала через тканевый фактор регулируется белком дисульфидизомеразой; на фиг. 3 - передача сигнала через усеченный тканевый фактор; на фиг. 4 показано, что передача сигнала через TF-VIIa стимулирует рост опухоли; на фиг. 5 - распределение эпитопов для MAT 10H10; на фиг. 6 показано, что инактивация коагулирующей активности TF зависит от оксида азота; на фиг. 7 показано, что образование комплекса TF-PAR2 необходимо для передачи сигнала черезTF-VIIa. Подробное описание изобретения В одном аспекте настоящее изобретение предусматривает композиции и способы лечения нарушения передачи сигнала через тканевый фактор/фактор VIIa (TF/VIIa) (например, у субъектов с избыточной передачей сигнала через TF/VIIa) и лечения субъектов, страдающих заболеваниями или патологическими состояниями, которые зависят от, опосредованы или связаны с передачей сигнала через TF/VIIa. Нарушение передачи сигнала через TF/VIIa относится к избыточной или недостаточной активности передачи сигнала через тканевый фактор/фактор VIIa (TF/VIIa), по сравнению с таковой у здоровых субъектов. Заболевания, зависящие от передачи сигнала через TF/VIIa, охватывают любые расстройства или патологические состояния, возникновение или развитие которых опосредовано или связано с нарушением активности передачи сигнала через TF/VIIa. Примеры таких заболеваний включают воспаление, неопла-3 014900 стические заболевания и заболевания, зависимые от ангиогенеза. Заболевания, зависимые от ангиогенеза,охватывают заболевания или расстройства с избыточным ангиогенезом (например, рак, слепота, вызванная диабетом, возрастная дистрофия желтого пятна, ревматоидный артрит и псориаз) или недостаточным ангиогенезом (например, болезнь коронарных артерий, инсульт и медленное заживление ран). Обычно,композиции согласно настоящему изобретению включают ингибитор пути передачи сигнала черезTF/VIIa, который не нарушает TF-опосредуемый гемостаз (например, свертывание крови). Способы согласно настоящему изобретению включают введение эффективного количества такого ингибитора субъекту, относящемуся к млекопитающим, нуждающемуся в лечении. Указанный ингибитор эффективен для снижения количества случаев воспаления или неопластического заболевания без увеличения риска кровотечения у субъекта. Указанный ферментативный комплекс рецептора клеточной поверхности - тканевого фактора (TF) с сериновой протеазой (фактором VIIa) активирует физиологический гемостаз и свертывание и одновременно запускает активируемую протеазами передачу сигнала через рецептор при воспалении, прогрессировании опухоли и ангиогенезе. Mackman, Arterioscler. Thromb. Vasc. Biol. 24: 1015-1022, 2004; Riewald иRuf, Crit. Care 7: 123-129, 2003; Belting и др., Arterioscler. Thromb. Vasc. Biol. 25: 1545-1550, 2005. Каким образом предшествующие пути передачи сигнала напрямую через TF-VIIa определяют патологию, без подавления нарабатываемыми в большом количестве протеазами, участвующими в процессе свертывания крови, оставалось фундаментальным, неразрешенным вопросом биологии сосудов. Как подробно описано в примерах ниже, настоящее изобретение показывает, что внеклеточный белок дисульфидизомераза (PDI) ассоциирует с TF, обеспечивая регуляцию свертывания крови с сохранением передачи сигнала в клетке. Нарушение дисульфидной связи Cys186-Cys209 внеклеточного TF фенотипически копирует функциональные свойства регулируемого PDI сигнального TF. Таким образом, пути дисульфидного обмена действуют как внеклеточные переключатели специфичности функции рецептора. Моноклональное антитело, связывающее нативную конформацию сигнального TF, ингибировало ответы клетки и рост опухоли in vivo (например, опухоли молочной железы или меланомы). Прерывание патофизиологической передачи сигнала через TF без нарушения индуцируемого TF гемостаза является примером того,как функциональные переключатели дисульфидных связей можно применять в терапевтических целях. Очевидно, что настоящее изобретение не ограничено перечисленными конкретными способами,реагентами, соединениями, композициями или биологическими системами, которые могут, несомненно,варьировать. Также очевидно, что терминология данной заявки предназначена для описания конкретных вариантов реализации и не ограничивает изобретение. При использовании в настоящем описании изобретения и прилагаемой формуле изобретения формы единственного числа включают соответствующие формы множественного числа, если из контекста не следует обратное. Таким образом, например, термин"клетка" включает комбинацию двух или более клеток и т.д. В данной заявке термин "приблизительно" по отношению к измеряемой величине, такой как количество, продолжительность по времени, и тому подобные, как подразумевается, охватывает отклонение на 20% или на 10%, более предпочтительно на 5%, еще более предпочтительно на 1% и еще более предпочтительно на 0,1% от указанного значения, поскольку подобные отклонения подходят для выполнения изложенных способов. Если не указано иначе, все технические и научные термины, используемые в данной заявке, имеют же значения, очевидные для среднего специалиста в области, к которой относится настоящее изобретение. Хотя на практике для проверки настоящего изобретения можно применять любые способы и материалы, сходные или эквивалентные тем, которые описаны в данной заявке, предпочтительными являются материалы и способы, описанные в данной заявке. При описании и составлении формулы настоящего изобретения будет использована следующая терминология."Гемостаз" относится к остановке кровотечения из поврежденного кровеносного сосуда, требует совместного действия сосудистых, тромбоцитарных и плазматических факторов, уравновешенного регуляторными механизмами, для ограничения накопления тромбоцитов и фибрина в области повреждения. Нарушения гемостаза могут привести к тромбозу или избыточному кровотечению."Ангиогенез" относится к росту новых кровеносных сосудов у субъекта, относящегося к млекопитающим, здорового, либо в болезненном состоянии. Ангиогенез происходит в процессе заживления раны и для восстановления кровотока к тканям после повреждения или инсульта. У женщин ангиогенез также происходит в течение ежемесячного репродуктивного цикла (для восстановления выстилки матки, для созревания ооцитов во время овуляции) и во время беременности (для формирования плаценты, кровотока между матерью и плодом). В случае, когда продукция факторов роста ангиогенеза превышает выработку ингибиторов ангиогенеза, происходит рост кровеносных сосудов. В случае, когда количество ингибиторов превышает выработку стимуляторов, ангиогенез останавливается. Избыточный ангиогенез происходит при заболеваниях, включающих, но без ограничения, рак, воспаление, слепоту, вызванную диабетом, возрастную дистрофию желтого пятна, ревматоидный артрит и псориаз. При таких патологических состояниях новые кровеносные сосуды питают пораженные болезнью ткани, разрушают нормальные ткани и, в случае рака, позволяют опухоли метастазировать. Недос-4 014900 таточный ангиогенез происходит при заболеваниях, включающих, без ограничения, заболевание коронарных артерий, инсульт и медленное заживлении ран. При таких патологических состояниях образуются неполноценные кровеносные сосуды и не происходит правильного восстановления кровообращения,что приводит к риску смерти тканей. Лечение неопластического заболевания Неопластическое заболевание относится к раку или любому злокачественному росту или опухоли,вызванным не соответствующим норме и неконтролируемым делением клеток; оно может распространяться в другие области организма через лимфатическую систему или кровоток. "Солидная опухоль" включает, без ограничения, саркому, меланому, карциному или другие солидные раковые опухоли."Саркома" относится к опухоли, которая состоит из такого вещества, как эмбриональная соединительная ткань, и обычно состоит из плотно уложенных клеток, окруженных фибриллярным или гомогенным веществом. Саркомы включают, без ограничения, хондросаркому, фибросаркому, лимфосаркому,меланобластому, миксосаркому, остеосаркому, саркому Абемети (Abemethy), злокачественную липому,липосаркому, альвеолярную саркому мягких тканей, амелобластосаркому, ботриоидную саркому, гранулоцитарную саркому, хориокарциному, эмбриональную саркому, опухоль Вильмса (Wilms), саркому эндометрия, стромальную саркому, саркому Юинга (Ewing), фасциальную саркому, фибробластную саркому, злокачественную гигантоклеточную саркому, гранулоцитарную саркому, саркому Ходжкина (Hodgkin), идиопатическую множественную геморрагическую саркому, иммунобластическую саркому из Вклеток, лимфому, иммунобластическую саркому Т- из клеток, саркому Йенсена (Jensen), саркому Капоши (Kaposi), саркому купферовских клеток, ангиосаркому, лейкосаркому, злокачественную мезенхимому, паростальную саркому, саркому ретикулоцитов, саркому Рауса (Raus), листовидную цистосаркому,синовиальную саркому и телеангиэктатическую саркому."Меланома" относится к опухоли, происходящей из системы меланоцитов кожи и других органов. Меланомы включают, например, лентигиноз конечностей, амеланотическую меланому, доброкачественную юношескую меланому, меланому Клаудмена (Cloudman), меланому S91, меланому Хардинга-Пасси(Harding-Passey), юношескую меланому, ограниченный предраковый меланоз, злокачественную меланому, узелковую меланому, подногтевую меланому и меланому поверхностно распространяющегося типа."Карцинома" относится к злокачественному новообразованию, состоящему из клеток эпителия,имеет тенденцию к инфильтрации окружающих тканей и приводит к метастазам. Примеры карцином включают, например, ацинарную карциному, ацинозную карциному, аденоцистокарциному, аденокистозную карциному, аденоматозную карциному, карциному коры надпочечников, альвеолярную карциному, карциному альвеолярных клеток, карциному базальных клеток, базальноклеточную basocellulare карциному, базалоидную карциному, базоплоскоклеточную карциному, бронхио-альвеолярную карциному, бронхиолярную карциному, бронхогенную карциному, мозговидную карциному, холангиоцеллюлярную карциному, хориокарциному, коллоидную карциному, угревидную карциному, карциному тела,ситовидную карциному, панцирную карциному, карциному кожи, карциному цилиндрического типа,карциному цилиндрических клеток, карциному протоков, твердую карциному, эмбриональную карциному, мозговидную карциному, эпидермоидную карциному, эпителиальную аденоидную карциному, экзофитную карциному, карциному из язвы, фиброзную карциному, листовидную карциному, слизеобразующую карциному, гигантоклеточную карциному (карциному gigantocellulare), железистую карциному,гранулезоклеточную карциному, базально-клеточную карциному, гематоидную карциному, печеночноклеточную карциному, карциному клеток Гюртле, хондрому, гипемефроидную карциному, детскую эмбриональную карциному, карциному in situ, внутриэпидермальную карциному, внутриэпителиальную карциному, карциному Кромпечера (Krompecher), карциному клеток Кульчитски (Kulchitzky), крупноклеточную карциному, чечевицеобразную карциному, лентикулярную карциному (lenticulare), липоматозную карциному, лимфоэпителиальную карциному, медуллярную карциному (medullare), меланотическую карциному, мягкую карциному, слизеобразующую карциному, карциному muciparum, карциному слизеобразующих клеток, слизеобразующую плоскоклеточную карциному, карциному mucosum (карциному слизистых), карциному myxomatodes, назофарингиальную карциному, овсяноклеточную карциному, оссифицирующую карциному, остеоидную карциному, папиллярную карциному, перипортальную карциному, прединвазивную карциному, карциному шиловидных клеток, коллоидную карциному, светлоклеточную карциному почки, карциному резервных клеток, саркомоподобный рак, карциному слизистой оболочки носовой полости, фиброзную карциному, карциному мошонки, перстневидно-клеточную карциному, недифференцированную карциному, мелкоклеточную карциному, соленоидную карциному,карциному из сферических клеток, веретеноклеточную карциному, губчатую карциному, сквамозную карциному, плоскоклеточную карциному, нитевидную карциному, телеангиэктатическую карциному,карциному из гладких мышечных волокон и сосудистой ткани, переходно-клеточную карциному, карциному tuberosum, туберозную карциному, бородавчатую карциному и карциному viflosum."Лейкемия" относится к прогрессирующим, злокачественным заболеваниям органов кроветворения и обычно характеризуется измененной пролиферацией и развитием лейкоцитов и их предшественников в крови и костном мозге. Лейкемию обычно клинически классифицируют на основании (1) продолжительности и характера заболевания - острая или хроническая; (2) типа вовлеченных в ее образование клеток -5 014900 миелоидная (миелогенная), лимфоидная (лимфогенная) или моноцитарная и (3) наличия или отсутствия увеличения изменения числа аберрантных клеток в крови - лейкемическая или алейкемическая (сублейкемическая). Лейкемия включает, например, острый нелимфоцитарный лейкоз, хронический лимфолейкоз, острый гранулоцитарный лейкоз, хронический гранулоцитарный лейкоз, острый промиелоцитарный лейкоз, Т-клеточный лейкоз взрослых, алейкемический лейкоз, лейкоцитемический лейкоз, базофильный лейкоцитоз, лейкоз бластных клеток, коровий лейкоз, хронический миелоцитарный лейкоз, лейкоз кожи,эмбриональный лейкоз, эозинофильный лейкоз, лейкоз Гросса, волосатоклеточный лейкоз, лейкоз гемобластов, лейкоз гемоцитобластов, гистиоцитарный лейкоз, недифференцируемый лейкоз, острый моноцитарный лейкоз, лейкопенический лейкоз, лимфолейкоз, лимфобластный лейкоз, лимфоцитарный лейкоз, лимфогенный лейкоз, лимфоидный лейкоз, лейкоз клеток лимфосаркомы, тучноклеточный лейкоз,мегакариоцитарный лейкоз, микромиелобластный лейкоз, моноцитарный лейкоз, лейкоз миелобластов,миелоцитарный лейкоз, миелоидный гранулоцитарный лейкоз, миеломоноцитарный лейкоз, лейкоз Негели (Naegeli), плазмоклеточный лейкоз, плазмоцитарный лейкоз, промиелоцитарный лейкоз, лейкоз клеток Ридера, лейкоз Шиллинга (Shilling's), недифференцированный бластный лейкоз, сублейкемический лейкоз и лейкоз недифференцированных клеток. Дополнительные виды рака включают, например, болезнь Ходжкина, не-ходжкинскую лимфому,множественную миелому, нейробластому, рак молочной железы, рак яичников, рак легких, рабдомиосаркому, первичный тромбоцитоз, первичную макроглобулинемию, мелкоклеточные опухоли легких,первичные опухоли головного мозга, рак желудка, рак толстого кишечника, злокачественную панкреатическую инсулиному, злокачественный карциноид, рак мочевого пузыря, предзлокачественные повреждения кожи, рак яичка, лимфомы, рак щитовидной железы, нейробластому, рак пищевода, рак мочеполового тракта, злокачественную гиперкальцемию, рак шейки матки, рак эндометрия, рак коры надпочечников и рак предстательной железы. Лечение воспаления(ответам) с активными воспалительными процессами) и хроническим реакциям (т.е., к ответам, характеризующимся медленным развитием и образованием новой соединительной ткани). Острое и хроническое воспаление можно различить по типу участвующих в нем клеток. Острое воспаление часто включает полиморфоядерные нейтрофилы; тогда как хроническое воспаление обычно характеризуется лимфогистиоцитарным и/или гранулематозным ответом. Воспаление включает реакцию систем как специфической, так и неспецифической защиты. Реакция системы специфической защиты представляет собой специфический ответ иммунной системы на антиген (возможно, включающий аутоантиген). Реакция системы неспецифической защиты представляет собой воспалительную реакцию, опосредуемую лейкоцитами,не способными к иммунологической памяти. Такие клетки включают гранулоциты, макрофаги, нейтрофилы и эозинофилы. Примерами воспаления специфического типа являются диффузное воспаление, фокальное воспаление, крупозное воспаление, интерстициальное воспаление, облитерирующее воспаление,паренхиматозное воспаление, реактивное воспаление, специфическое воспаление, токсическое воспаление и травматическое воспаление. Защита животного от заболевания, включающего воспаление, относится к снижению способности к воспалительному ответу (т.е., ответу, включающему воспаление) на воспалительный агент (т.е., агент,способный вызвать воспалительный ответ, например метахолин, гистамин, аллерген, лейкотриен, солевой раствор, гипервентиляция, физическая нагрузка, диоксид серы, аденозин, пропранолол, холодный воздух, антиген и брадикинин). Предпочтительно способность к воспалительному ответу снижена, оптимально, до такой степени, при которой животное уже не испытывает дискомфорт и/или нарушение функционирования из-за эффекта воспалительного агента. Например, защита животного может относиться к способности соединения, при введении его животному, предотвращать начало заболевания и/или излечивать или снижать выраженность симптомов, признаков или причин заболевания. В частности, защита животного относится к модуляции воспалительного ответа для подавления (например, снижения, ингибирования или остановки) чрезмерно активного или опасного воспалительного ответа. Также защита животного относится, в частности, к регуляции клеточного иммунитета и/или гуморального иммунитета (т.е., активности Т-клеток и/или активности IgE). Заболевание относится к любому отклонению от нормального состояния здоровья животного и включает симптомы заболевания, а также патологические состояния, при которых отклонение (например, инфекция, генная мутация, генетический дефект и т.д.) уже произошло, но симптомы еще не проявились. Терапия антителами В некоторых вариантах реализации настоящее изобретение предусматривает способы ингибирования или подавления передачи сигнала через TF/VIIa у субъекта, относящегося к млекопитающим, у которого необходимо снизить или подавить сигнальную активность TF/VIIa (например, субъекта, страдающего от воспаления или опухоли). Указанные способы включают введение ингибитора передачи сигнала через TF/VIIa субъекту, относящемуся к млекопитающим, в количестве, эффективном для ингибирования или подавления передачи сигнала через TF/VIIa. В некоторых родственных вариантах реализации настоящее изобретение обеспечивает способы лечения или снижения выраженности симптомов за-6 014900 болеваний, которые связаны или зависят от передачи сигнала через тканевый фактор/фактор VII, у субъекта, относящегося к млекопитающим. Как отмечалось выше, такие заболевания включают, например,связанные с ангиогенезом заболевания, неопластические заболевания или воспаление. Указанные способы включают введение ингибитора передачи сигнала через тканевый фактор субъекту, относящемуся к млекопитающим, в количестве, эффективном для снижения или устранения связанного с ангиогенезом заболевания, неопластического заболевания или воспаления, или предотвращения его возникновения или рецидива у субъекта, относящегося к млекопитающим. В некоторых вариантах реализации в настоящем изобретении применяют ингибитор, который представляет собой антитело к тканевому фактору, ингибирующее передачу сигнала через тканевый фактор и не нарушающее гемостаз (например, свертывание крови) у субъекта, относящегося к млекопитающим. Типичное антитело относится к полипептиду, включающему каркасную область гена иммуноглобулина или фрагмента иммуноглобулина, который специфическим образом связывает и узнает антиген. Известные гены иммуноглобулинов включают гены каппа, лямбда, альфа, гамма, дельта, эпсилон и мю константной области, а также мириады генов вариабельной области иммуноглобулинов. Легкие цепи классифицируют как каппа или лямбда. Тяжелые цепи классифицируюткак гамма, мю, альфа, дельта,или эпсилон, которые, в свою очередь, определяют классы иммуноглобулинов, IgG, IgM, IgA, IgD и IgE,соответственно. Обычно, антигенсвязывающая область антитела является наиболее существенной для специфичности и аффинности связывания. Антитела и полученные из антител антигенсвязывающие молекулы обозначают полипептидную цепь(и), которая проявляет сильное моновалентное, бивалентное или поливалентное связывание с данным эпитопом или эпитопами (например, TF или специфический эпитоп пептида TF, узнаваемый MAT 10H10). Если не указано другое, антитела или антигенсвязывающие молекулы согласно настоящему изобретению могут иметь последовательности, происходящие из любого вида позвоночных, камелидов,птиц или рыб. Их можно получить с применением любой подходящей технологии, например гибридомной технологии, рибосомного дисплея, фагового дисплея, библиотеки перестановки генов, полусинтетических или полностью синтетических библиотек или их комбинаций. Как подробно описано в данной заявке, антитела или антиген-связывающие молекулы настоящего изобретения включают интактные антитела, антиген-связывающие полипептидные цепи и другие сконструированные антитела (см., например, Serafini, J. Nucl Med. 34:533-6, 1993). Антитело или антигенсвязывающая молекула также включает фрагменты антитела, которые содержат антигенсвязывающие области интактного антитела, сохраняющие способность к связыванию своего антигена (например, TF или конкретный эпитоп пептида TF, узнаваемого МАТ 10 Н 10). Примеры таких фрагментов антител включают: (i) фрагмент Fab, моновалентный фрагмент, состоящий из доменовVL, VH, CL и СН 1; (ii) фрагмент F(ab')2, бивалентный фрагмент, включающий два фрагмента Fab, связанных дисульфидным мостиком в шарнирной области; (iii) фрагмент Fd, состоящий из доменов VH и СН 1; (iv) фрагмент Fv, состоящий из доменов VL и VH одного плеча антитела, (v) фрагмент dAb (Ward и др, Nature 341:544-546, 1989), который состоит из домена VH; и (vi) изолированный гипервариабельный участок (CDR). Более того, хотя два домена фрагмента Fv, VL и VH кодируются отдельными генами, их можно объединить, применяя рекомбинантные методы, с помощью синтетического линкера, который позволяет им образовать единую белковую цепь, в которой участки VL и VH соединены и образуют моновалентные молекулы (известные как одноцепочечные Fv (scFv); см., например, Bird и др., Science 242:423-426, 1988; и Huston и др., Proc, Natl. Acad. Sci. USA 85:5879-5883, 1988. Антитела или антигенсвязывающие молекулы согласно настоящему изобретению дополнительно включают одну или более цепей иммуноглобулинов, которые химически конъюгированы с или экспрессируются как гибридные белки с другими белками. Они также включают биспецифические антитела. Биспецифическое или бифункциональное антитело представляет собой искусственное гибридное антитело, имеющее две различные пары тяжелых/легких цепей и два различных сайта связывания. Другие антигенсвязывающие фрагменты или участки антител согласно настоящему изобретению включают бивалентные scFv (диательца, diabody), биспецифические антитела scFv, в которых молекула антитела узнает два различных эпитопа, одиночные домены связывания (dAb) и миниантитела. Различные антитела или антигенсвязывающие фрагменты, описанные в данной заявке, можно получить путем ферментативной или химической модификации интактных антител или синтезировать denovo с применением методик рекомбинантной ДНК (например, одноцепочечные Fv), либо выявить с помощью библиотек фагового дисплея (см., например, McCafferty и др., Nature 348:552-554, 1990). Например, миниантитела можно получить, применяя способы, описанные в данной области, например,Vaughan и Sollazzo, Comb Chem High Throughput Screen. 4:417-30 2001. Биспецифические антитела можно получить множеством способов, включая слияние гибридом или сшивку фрагментов Fab'. См., например, SongsivilaiLachmann, Clin. Exp. Immunol. 79:315-321 (1990); Kostelny и др., J. Immunol. 148, 15471553 (1992). Одноцепочечные антитела можно идентифицировать с применением библиотек на основе фагового дисплея или библиотек на основе рибосомного дисплея, библиотек перетасовки генов. Такие библиотеки можно сконструировать из синтетических, полусинтетических или наивных и иммунокомпе-7 014900 тентных материалов. Одним конкретным примером антител, которые можно применять при осуществлении на практике приведенных выше способов терапии, является моноклональное антитело мыши, обозначенное 10 Н 10. Как показано в примерах ниже, MAT 10H10 представляет собой антитело, которое действует как ингибитор передачи сигнала через тканевый фактор без нарушения гемостаза. Это антитело было детально описано в патентах США с номерами 5223427 и 6001978. Гибридома, секретирующая это антитело, депонирована согласно требованиям Будапештской конвенции в Американской коллекции типовых культур(АТСС) (Манассас, Вирджиния) 27 марта 1987 с номером доступа НВ 9383. В дополнение к антителу 10H10, продуцируемому этой гибридомой, любое антитело, которое обладает такой же специфичностью связывания и такой же или лучшей аффинностью связывания, чем MAT 10H10, можно также применять в способах терапии согласно настоящему изобретению. Кроме того, в способах терапии согласно настоящему изобретению можно также применять антигенсвязывающую молекулу или фрагменты, которые получены из MAT 10H10, или антитело с такой же специфичностью связывания и такой же аффинностью связывания, как у МАТ 10 Н 10, или лучшей. Некоторые из способов терапии согласно настоящему изобретению относятся к лечению субъектовлюдей. В таких способах предпочтительными являются гуманизированное антитело, антитело человека или химерное антитело, содержащее последовательности человека (например, в константной области). По сравнению с антителом, выделенным из организма животного, не являющегося человеком (например,мыши), такое антитело будет иметь меньшую антигенность или вообще не будет обладать антигенными свойствами при введении пациенту-человеку. Химерное антитело к TF (например, с такой же специфичностью связывания, как у MAT 10H10) можно получить из участков антитела к TF животного, не являющегося человеком, вместе с участками антител человека. Например, химерная тяжелая цепь может включать антигенсвязывающий участок вариабельной области тяжелой цепи антитела к TF мыши, как указано в примерах данной заявки, связанный с по меньшей мере частью константной области тяжелой цепи антитела человека. Такую химерную тяжелую цепь можно объединить с химерной легкой цепью,которая включает антигенсвязывающий участок вариабельной области легкой цепи антитела к TF мыши,связанный с по меньшей мере частью константной области легкой цепи антитела человека. Химерные антитела к TF согласно настоящему изобретению можно получить в соответствии со способами, известными в данной области. См., например, Robinson и др., международная публикация патента PCT/US86/02269; Akira, и др., европейская заявка на патент 184187; Taniguchi, М., европейская заявка на патент 171496; Morrison и др., европейская заявка на патент 173494; Neuberger и др., международная заявка на патент WO 86/01533; Cabilly и др., патент США с номером 4816567; Cabilly и др., европейская заявка на патент 125023; Better и др., Science 240:1041-1043, 1988; Liu и др., PNAS 84:3439-3443,1987; Liu и др., J. Immunol. 139:3521-3526, 1987; Sun и др., PNAS 84:214-218, 1987; Nishimura и др., Canc.Res. 47:999-1005, 1987; Wood и др., Nature 314:446-449, 1985; Shaw и др., J. Natl. Cancer Inst. 80:15531559, 1988. Химерные антитела, которые целиком включают вариабельные области антитела животного, не являющегося человеком, можно дополнительно гуманизировать для снижения антигенности этого антитела для человека. Гуманизацию антитела обычно выполняют путем замещения некоторых последовательностей или остатков аминокислот в вариабельных областях Fv (каркасных областях или участках, отличных от CDR) эквивалентными последовательностями или остатками аминокислот из вариабельных областей Fv антител человека. Такие содержащие дополнительные замены последовательности или остатки аминокислот обычно не участвуют непосредственно в связывании антигена. Чаще гуманизацию антитела животного, не являющегося человеком, проводят путем замещения только CDR антитела животного, не являющегося человеком, (например, анти-TF антитела мыши, приведенные в качестве примера в данной заявке) на CDR антитела человека. В некоторых случаях после этого необходимо дополнительное замещение нескольких остатков в каркасных областях антитела человека на соответствующие остатки донорного антитела животного, не являющегося человеком. Такая дополнительная пересадка (grafting) часто необходима для улучшения связывания с антигеном. Причиной этого является то, что гуманизированные антитела, в составе которых находятся только CDR, пересаженные от антитела животного, не являющегося человеком, могут иметь меньшую активность связывания, по сравнению с активностью связывания донорного антитела животного, не являющегося человеком. Таким образом, в добавление к CDR,гуманизированные антитела к TF человека согласно настоящему изобретению (например, с такой же специфичностью связывания, как у MAT 10H10) часто могут содержать некоторые остатки аминокислот в каркасной области антитела человека, замещенные на соответствующие остатки донорного антитела животного, не являющегося человеком (например, антитела мыши, приведенного в качестве примера в данной заявке). Способы получения гуманизированных антител путем замещения CDR, включая критерии отбора остатков каркасной области для замещения, хорошо известны в данной области. См., например, Winter и др., заявка на патент Великобритании GB 2188638A (1987), патент США 5,225,539; Jones и др., Nature 321:552-525, 1986; Verhoeyan и др., Science 239:1534, 1988; Beidler и др., J. Immunol. 141:40534060, 1988; и WO 94/10332.-8 014900 В добавление к химерным или гуманизированным антителам к PAR1 человека в способах терапии для лечения людей можно также применять антитела, полностью принадлежащие человеку, которые проявляют такую же специфичность связывания с антителом мыши, таким как MAT 10H10, и сравнимую млм лучшую аффинность. Антитела к TF человека можно получить, применяя любой из указанных методов, которые хорошо известны в данной области, например методы фагового дисплея с применением библиотек антител, полученных из последовательностей иммуноглобулинов человека. См., например,Lonberg и Huszar, Int. Rev. Immunol. 13:65-93 (1995), патенты США с номерами 4,444,887 и 4,716,111; и публикации РСТ WO 98/46645, WO 98/50433, WO 98/24893, WO 98/16654, WO 96/34096, WO 96/33735 иWO 91/10741. Производные антитела или антигенсвязывающие молекулы, имеющие такую же специфичность связывания, что и MAT 10H10, и такую же или лучшую аффинность связывания, можно получить методами, хорошо известными в данной области и приведенными в качестве примеров в данной заявке. Например, антитела или иммуноглобулины - кандидаты, полученные из тканевого фактора в качестве антигена, можно подвергнуть скринингу, например, на способность конкурировать с MAT 10H10 за связывание с полипептидом или пептидом тканевого фактора. Полипептидные и полинуклеотидные последовательности тканевого фактора человека известны (см., например, Scarpati и др., Biochemistry 26:5234-5238,1987; и Fisher и др., Thromb. Res. 48:89-99, 1987). Полипептиды или пептиды тканевого фактора, подходящие для скрининга, можно получить, применяя способы, хорошо известные в данной области или описанные в данной заявке. Кроме того, группа специфичных антигенных пептидов, полученных из тканевого фактора человека, была описана в данной области, например, в патентах США с номерами 5,223,427 и 6,001,978. Эти патенты также раскрывают профиль связывания MAT 10H10 с указанной группой пептидов тканевого фактора. Например, было показано, что МАТ 10 Н 10 специфично связывается с пептидом тканевого фактора с последовательностью SGTTNTVAAYNLTWKSTNFKTILEWEPKPV (SEQ IDN0:1) или ECDLTDEIVKDVKQTY (SEQ ID N0:2), но не связывается с несколькими другими антигенными пептидами, полученными из тканевого фактора человека. Последние пептиды включают, например,TKSGDWKSKCFYTTDTECDLTDEIVKDVKQTY (SEQ ID N0:3) или LARVFSYPAGNVESTGSAGEPLYENSPEFTPYLC (SEQ ID N0:4). Таким образом, антитела-кандидаты (например, антитела, полученные против полипептида тканевого фактора человека) можно подвергнуть скринигу на способность блокировать связывание MAT 10H10 с пептидом с последовательностью SEQ ID N0:1 и/или SEQ ID N0:2. Антитела также можно подвергнуть скринигу на профиль связывания, идентичный или, по существу,идентичный MAT 10H10, по связыванию с панелью пептидов тканевого фактора человека, как описано в патенте США с номером 5223427. Способы выполнения такого скрининга хорошо известны в данной области (см., например, патенты США с номерами 5223427 и 6001978), а также описаны в данной заявке.B добавление к скрининг-тестам in vitro можно также применять способы идентификации антител кTF (анти-TF антител) in vivo, которые подходят для реализации указанных способов согласно настоящему изобретению. Например, способ замены in vivo вариабельной области антитела животного, не являющегося человеком, на вариабельную область антитела человека, с сохранением или обеспечением лучших характеристик связывания, был раскрыт в заявке на патент США с номером 10/778,726 (номер публикации 20050008625). Предназначенный для получения антитела человека с такой же специфичностью связывания, что и у MAT 10H10 мыши, и такой же или лучшей аффинностью связывания, этот способ основывается на направленной замене эпитопов вариабельных областей антитела животного, не являющегося человеком, на соответствующие участки антитела, полностью принадлежащего человеку. Полученное антитело человека обычно не имеет сходной структуры с исходным антителом животного,не являющегося человеком, но связывается с тем же эпитопом на том же антигене, что и исходное антитело. Антитела человека с близкой или лучшей аффинностью к специфичному эпитопу, чем у исходного антитела животного, не являющегося человеком (например, MAT 10H10 мыши), также можно приобрести у компаний, которые обычно производят антитела человека. Например, для получения необходимого антитела человека KaloBios, Inc. (Маунтин Вью, Калифорния) применяет библиотеку "акцепторных" антител человека. Затем производят направленную или эпитоп-фокусированную библиотеку антител человека, которые связываются с теми же эпитопами, что и антитело животного, не являющегося человеком,хотя и с различными аффинностями. Антитела из основанной на эпитопах библиотеке затем отбирают на основании близкой или более высокой аффинности, чем аффинность исходного антитела животного, не являющегося человеком. Идентифицированные таким образом антитела человека затем подвергают дополнительному анализу на аффинность и идентичность последовательности. В добавление к MAT 10H10 и антителам или антигенсвязывающим молекулам, полученным на его основе, другие антитела к TF с необходимыми для реализации способов терапии соглано настоящему изобретению свойствами также легко можно получить с применением методик и способов, которые обычно осуществляют в данной области. Как очевидно специалистам в данной области, биоспецифические захватывающие реагенты включают антитела и связывающие фрагменты антител, которые связываются с тканевым фактором, например, на метастатических клетках или клетках воспаления (например,одноцепочечные антитела, фрагменты Fab', фрагменты F(ab)'2 и белки scFv, и аффитела (Affibody, ул.Teknikringen 30, floor 6, Box 700 04, Stockholm SE-10044, Швеция; См. патент США с номером: 5831012,который включен в данную заявку посредством ссылки в полном объеме и во всех отношениях. В зависимости от предполагаемого применения, они могут также включать рецепторы и другие белки, которые специфическим образом связывают другие биомолекулы. Гибридные антитела и фрагменты гибридных антител включают целые молекулы антител, содержащие полноразмерные тяжелую и легкую цепи, или любые их фрагменты, такие как Fab, Fab', F(ab')2,Fd, scFv, легкие цепи антител и тяжелые цепи антител. Также можно применять химерные антитела, содержащие вариабельные области, как описано в данной заявке, и константные области различных видов организмов. См., например, заявку на патент США номер 20030022244. На начальном этапе заранее выбирают целевой объект, к которому будут получать антитело. Методики получения моноклональных антител против целевых объектов хорошо известны специалистам в данной области. Примеры таких методик включают, без ограничения, методики с применением библиотек на основе дисплея, мышей хепо или HuMAb, гибридомы и тому подобное. Целевые объекты включают любые вещества, которые способны проявлять антигенность, и они обычно представляют собой белки или полисахариды белков. Примеры включают рецепторы, ферменты, гормоны, факторы роста,пептиды и тому подобные. Очевидно, что не только природные антитела подходят для применения в соответствии с настоящим описанием, но также можно применять и рекомбинантные антитела и фрагменты антител, направленых против заранее выбранного объекта. Антитела (AT), которые можно подвергнуть методикам, указанным в данной заявке, включают моноклональные и поликлональные AT, и фрагменты антител, такие как Fab, Fab', F(ab')2, Fd, scFv, диабоди,легкие цепи антител, тяжелые цепи антител и/или фрагменты антител, полученные с помощью технологии фагового или фагмидного дисплея. Сначала исходное антитело получают из исходных видов. В частности, необходимо иметь последовательность нуклеиновых кислот или аминокислот вариабельной части легкой цепи, тяжелой цепи или обеих из антитела исходного вида, обладающего специфичностью к целевому антигену. Исходные виды представляют собой любые виды, которые применяют для получения антитела или библиотек антител, например крысу, мышь, кролика, цыпленку, обезьяну, человека и тому подобные. Методики для получения и клонирования моноклональных антител хорошо известны специалистам в данной области. После получения необходимого антитела вариабельные области (VH иVL) разделяют на составные части (т.е., каркасные области (FR) и CDR), при этом CDR определяют любым из возможных способов (например, способу по Kabat в отдельности, способу по Chothia в отдельности или с применением комбинированного способа по Kabat и Chothia, и любым другим способом определения, известным специалистам в данной области). После этого необходимо выбрать каркасные области подходящих целевых видов. Один вариант реализации подразумевает выравнивание каждой отдельной каркасной области последовательности антитела исходного вида с различными последовательностями аминокислот или последовательностями нуклеиновых кислот целевого вида. Программы поиска гомологичных последовательностей хорошо известны в данной области, например BLAST и тому подобные. Например, если целевой вид представляет собой человека, источники таких последовательностей аминокислот или последовательностей нуклеиновых кислот (зародышевые или перетасованные последовательности антител) можно найти в любой подходящей справочной базе данных, такой как Genbank,банк данных по белкам на сайте NCBI (http://ncbi.nlm.nih.gov/BLAST/), VBASE, база данных генов антител человека (http://www.mrc-cpe.cam.ac.uk/imt-doc) и базе данных Kabat по иммуноглобулинам(http://www.immuno.bme.nwu.edu) или их транслированным продуктам. При выравнивании последовательностей нуклеотидов необходимо проанализировать выбранные гены для определения того, какие гены из этой группы имеют наибольшую гомологию аминокислот с антителом исходного вида. Предполагается, что последовательности аминокислот или последовательности нуклеиновых кислот, имеющие более высокую по сравнению с другими последовательностями в базе данных степень гомологии, можно применять и изменять в соответствии с процедурами, описанными в данной заявке. Более того, можно применять последовательности аминокислот или генов, имеющие меньшую гомологию, в случае если они кодируют продукт, который, если его изменить и отобрать необходимые варианты в соответствии с процедурами, описанными в данной заявке, проявляет специфичность к заранее выбранному целевому антигену. В некоторых вариантах реализации приемлемая степень гомологии выше, чем приблизительно 50%. Очевидно, что целевым видом может быть вид, отличный от человека."Лечение" относится к любому признаку благоприятного исхода при лечении или снижении выраженности или терапии рака или воспаления, включая любой объективный или субъективный параметр,такой как смягчение боли или выраженности симптома; ремиссия; снижение выраженности симптомов или приведение болезненного состояния к более терпимой для пациента форме; замедление скорости дегенерации или ухудшения; или снижение истощения в результате дегенарции. Лечение или снижение выраженности симптомов может быть основано на объективных или субъективных параметрах; в том числе результатах осмотра лечащим врачом. В соответствии с этим термин "лечение" включает введение указанных соединений или агентов согласно настоящему изобретению для предотвращения или задержки, облегчения или подавления, или ингибирования развития симптомов или патологических состояний,связанных с глазными болезнями. Термин "терапевтический эффект" относится к снижению, устранению- 10014900 или предотвращению заболевания, симптомов заболевания, или побочных эффектов заболевания у субъекта."В комбинации с", "комбинированная терапия" и "комбинированные продукты" в некоторых вариантах реализации относятся к одновременному введению пациенту первого терапевтического препарата и соединений согласно данной заявке. При введении в комбинации компоненты можно вводить одновременно или последовательно в любом порядке в различные моменты времени. Таким образом, для обеспечения желаемого терапевтического эффекта все компоненты можно вводить по отдельности, но с достаточно небольшими интервалами времени."Лечить" или "лечение" рака, метастатического рака или воспаления с применением указанных способов согласно настоящему изобретению включает предотвращение появления симптомов у субъекта, у которого может быть повышен риск возникновения рака или воспаления, но он еще не испытывает или не демонстрирует симптомы инфекции; подавление симптомов рака или воспаления (замедление или остановка их развития); обеспечение снижения выраженности симптомов или побочных эффектов рака или воспаления (включая паллиативное лечение), и ослабление симптомов рака или воспаления (вызывающее регрессию). "Лечение" относится к любому признаку благоприятного исхода при лечении или улучшении состояния или терапии рака или воспаления, включающему любой объективный или субъективный параметр, такой как смягчение боли или выраженности симптома; ремиссия; ослабление симптомов или приведение болезненного состояния к более терпимой для пациента фотме; замедление скорости дегенерации или ухудшения; или снижение истощения в результате дегенарции. Лечение или снижение выраженности симптомов может быть основано на объективных или субъективных параметрах; в том числе результатах осмотра лечащим врачом. В соответствии с этим термин "лечение" включает введение указанных соединений или агентов согласно настоящему изобретению для предотвращения или задержки, облегчения или подавления, или ингибирования развития симптомов или патологических состояний, связанных с глазными болезнями. Термин "терапевтический эффект" относится к снижению выраженности, устранению или предотвращению заболевания, симптомов заболевания или побочных эффектов заболевания у субъекта."Единица дозирования" (лекарственная форма) относится к физически раздельным единицам, подходящим в качестве единичных доз для конкретного индивида, которому необходимо лечение. Каждая единица может содержать заранее выбранное количество активного соединения(ий), расчитаное для получения желаемого терапевтического эффекта(ов), объединенное с необходимым фармацевтическим носителем. Технические требования для лекарственной формы, содержащей единичную дозу, могут определяться (а) уникальными характеристиками активного соединения(ий) и конкретным терапевтическим эффектом(ами), которого нужно достичь, и (б) характерными ограничениями в данной области на приготовление лекарственного средства из такого активного соединения(ий). Термины "идентичный" или процент "идентичности", в отношении двух или более последовательностей нуклеиновых кислот или полипептидов, относится к двум или более последовательностям или подпоследовательностям, которые схожи или имеют определенное процентное содержание одинаковых остатков аминокислот или нуклеотидов (т.е., приблизительно 60% идентичности, предпочтительно 65,70, 75, 80, 85, 90, 91, 92, 93, 94, 95, 96, 97 98, 99% или более высокий процент идентичности по всему заданному участку (например, последовательность нуклеотидов, кодирующая тканевый фактор или антитело к тканевому фактору, описанные в данной заявке, или последовательность аминокислот тканевого фактора или антитела к тканевому фактору, описанные в данной заявке), при сравнении и выравнивании по максимальному соответствию во всем окне сравнения или обозначенном участке). Еео измеряют, используя алгоритмы сравнения последовательностей BLAST или BLAST 2.0 с параметрами по умолчанию, описанными ниже, или путем выравнивания вручную и визуального изучения (см., например, вебсайт NCBI). Такие последовательности считаются "по существу идентичными". Этот термин также относится или может быть применен в отношении последовательности, комплементарной тестируемой. Указанный термин также включает последовательности, которые содержат делеции и/или вставки, а также последовательности, содержащие замены. Как описано ниже, предпочтительные алгоритмы могут учитывать пробелы и тому подобное. Предпочтительно идентичность существует на протяжении участка длиной по меньшей мере приблизительно 25 аминокислот или нуклеотидов, или более предпочтительно на протяжении участка длиной 50-100 аминокислот или нуклеотидов. Для сравнения последовательностей, обычно одна последовательность выступает в качестве референсной последовательности, с которой сравнивают тестируемые последовательности. При использовании алгоритма сравнения последовательностей, тестируемые и референсную последовательности вводят в компьютер, указывают координаты подпоследовательности, если это необходимо, и указывают параметры алгоритма программы для сравнения последовательностей. Предпочтительно можно применять параметры программы по умолчанию, или можно указать альтернативные параметры. Алгоритм сравнения последовательностей затем рассчитывает процент идентичности последовательностей для тестируемых последовательностей по отношению к референсной последовательности на основании параметров программы."Окно сравнения", при использовании в данной заявке, включает обозначение сегмента из любого числа непрерывно следующих друг за другом позиций, выбранного из группы, состоящей из от 20 до 600, обычно от приблизительно 50 до приблизительно 200, чаще от приблизительно 100 до приблизительно 150, в котором последовательность можно сравнить с эталонной последовательностью из такого же числа непрерывно следующих друг за другом позиций, после оптимального выравнивания двух последовательностей. Способы выравнивания последовательностей с целью сравнения хорошо известны в данной области. Оптимальное выравнивание последовательностей с целью сравнения можно провести,например, с применением алгоритма локальной гомологии по Smith и Waterman, Adv. Appl. Math, 2: 482,1981, с применением алгоритма гомологичного выравнивания по Needleman и Wunsch, J. Mol. Biol,48:443, 1970, с применением способа поиска подобия по Pearson и Lipman, Proc. Natl. Acad. Sci. USA,85:2444, 1988, с применением компьютеризированных реализаций этих алгоритмов (GAP, BESTFIT,FASTA и TFASTA в пакете программного обеспечения Wisconsin Genetics Software Package, GeneticsComputer Group, 575 Science Dr., Мэдисон, Висконсин), или путем выравнивания вручную и визуального анализа (см., например, Ausubel и др., ред., Current Protocols in Molecular Biology. 1995, приложение). Предпочтительными примерами алгоритмов, которые подходят для определения процента идентичности последовательностей и сходства последовательностей, являются алгоритмы BLAST и BLAST 2.0, которые описаны в Altschul и др., Nuc. Acids Res, 25:3389-3402, 1977 и Altschul и др., J. Mol. Biol,215:403-410, 1990, соответственно. BLAST и BLAST 2.0 применяют с параметрами, описанными в данной заявке, для определения процента идентичности последовательностей нуклеиновых кислот и белков согласно настоящему изобретению. Программное обеспечение для выполнения анализа BLAST находится в свободном доступе на сайте Национального Центра Биотехнологической Информации(http://www.ncbi.nlm.nih.gov/). Данный алгоритм включает на первом этапе идентификацию пар последовательностей с высоким счетом (HSP) путем идентификации коротких слов длиной W вдоль последовательности, которые либо совпадают, либо удволетворяют некоторому положительному пороговому числу Т при выравнивании со словом той же длины в последовательности из базы данных. Т называют пороговым значением для близких слов (Altschul и др., выше). Такие первоначальные близкие совпадения слов служат отправными точками для обнаружения более длинных HSP, включающих их. Совпадающие слова продлевают в обоих направлениях вдоль каждой последовательности до тех пор, пока возможно повышение суммарного счета выравнивания. Суммарный счет расчитывают с применением в случае последовательностей нуклеотидов параметров М (вознаграждение за пару совпадающих остатков; всегда 0) и N (штраф за несовпадающие остатки; всегда 0). В случае последовательности аминокислот для расчета суммарного счета применяют матрицу значений. Продление совпадающих слов в каждом направлении прекращается, когда суммарный счет выравнивания уменьшается на величину X относительно его максимально достигнутого значения; суммарный счет сходит к нулю или ниже, в результате накопления одного или более остатков выравнивания с отрицательным значением; или по достижении конца любой из последовательностей. Параметры алгоритма BLAST, W, T и X определяют чувствительность и скорость выравнивания. Программа BLASTN (для последовательности нуклеотидов) использует в качестве параметров по умолчанию длину слова (W), равную 11, ожидание (Е), равное 10, М=5,N=-4, и сравнение осуществляется по обеим нитям. Для последовательностей аминокислот, программаBLASTP использует в качестве параметров по умолчанию длину слова, равную 3, и ожидание (Е), равное 10, и матрицу выравнивания BLOSUM62 (см. Henikoff и Henikoff, Proc. Natl. Acad. Sci. USA. 89:10915, 1989) (В), равное 50, ожидание (Е), равное 10, M=5, N=-4, и сравнение осуществляется по обеим нитям. Термины "полипептид", "пептид" и "белок" применяются в данной заявке взаимозаменяемо для обозначения полимера из остатков аминокислот. Термины применяют к полимерам аминокислот, в которых один или более остаток аминокислоты представляет собой искусственный химический миметик соответствующей природной аминокислоты, а также к природным полимерам аминокислот и неприродным полимерам аминокислот. Термин "аминокислота" относится к природным и синтетическим аминокислотам, а также к аналогам аминокислот и миметикам аминокислот, которые функционируют сходным с природными аминокислотами образом. Природными аминокислотами являются аминокислоты, кодируемые генетическим кодом, а также аминокислоты, которые затем подвергаются модификации, например гидроксипролин, карбоксиглутамат и О-фосфосерин. Аналоги аминокислот относятся к соединениям, которые имеют такую же основную химическую структуру, что и природные аминокислоты, т.е. -атом углерода, связанный с атомом водорода, карбоксильную группу, аминогруппу и группу заместителя R, например гомосерин, норлейцин, сульфоксид метионина, метилсульфоний метионина. Такие аналоги имеют измененныеR-группы (например, норлейцин) или измененные пептидные остовы, но сохраняют такую же основную химическую структуру, что и природные аминокислоты. Миметики аминокислот относятся к химическим соединениям, которые имеют структуру, отличную от общей химической структуры аминокислот,но которые функционируют сходным с природными аминокислотами образом. Аминокислоты могут обозначаться в данной заявке либо общепринятым трехбуквенным кодом, ли- 12014900 бо однобуквенным кодом, рекомендованным комиссией по биохимической номенклатуре IUPAC-IUB. Нуклеотиды также могут обозначаться общепринятым однобуквенным кодом "Консервативно измененные варианты", применяется как к последовательностям аминокислот, так и нуклеиновых кислот. По отношению к конкретным последовательностям нуклеиновых кислот, консервативно измененные варианты относятся к таким нуклеиновым кислотам, которые кодируют идентичные или по существу идентичные последовательности аминокислот, или когда нуклеиновая кислота не кодирует какую-либо последовательность аминокислот, к, по существу, идентичным последовательностям. Вследствие вырожденности генетического кода, любой данный белок кодируется большим числом функционально идентичных нуклеиновых кислот. Например, все кодоны GCA, GCC, GCG и GCU кодируют аминокислоту аланин. Таким образом, в любом положении, где аланин точно определен кодоном, сам кодон может быть любым из соответствующих указанных кодонов, при этом кодируемый полипептид не изменяется. Такие варианты нуклеиновых кислот называются "молчащими вариантами", которые представляют собой один из видов консервативно измененных вариантов. Каждая последовательность нуклеиновых кислот в данной заявке, которая кодирует полипептид, также описывает любой возможный молчащий вариант нуклеиновой кислоты. Для специалиста в данной области очевидно, что каждый кодон в нуклеиновой кислоте (кроме AUG, который обычно является единственным кодоном для метионина, и TGG,который обычно является единственным кодоном для триптофана) можно изменить для получения функционально идентичной молекулы. В соответствии с этим, подразумевается, что каждый молчащий вариант нуклеиновой кислоты, кодирующей полипептид, включен в каждую описанную последовательность в отношении продукта экспрессии, но не самой последовательности зонда. Что касается последовательностей аминокислот, для специалиста в данной области очевидно, что отдельные замены, делеции или вставки в последовательности нуклеиновой кислоты, пептида, полипептида, или белка, которые изменяют, добавляют или удаляют одну аминокислоту или небольшое, в процентном отношении, количество аминокислот в кодирующей последовательности, представляют собой"консервативно измененные варианты", в которых в результате изменения происходит замена одной аминокислоты на химически сходную аминокислоту. Таблицы консервативных замен, указывающие функционально сходные аминокислоты, хорошо известны в данной области. Такие консервативно измененные варианты являются дополнениями и не исключают полиморфные варианты, межвидовые гомологи и аллели согласно настоящему изобретению. Каждая из следующих восьми групп содержит аминокислоты, которые представляют собой консервативные замены друг для друга: 1) Аланин (А), Глицин (G); 2) Аспарагиновая кислота (D), Глутаминовая кислота (Е); 3) Аспарагин (N), Глутамин (Q); 4) Аргинин (R), Лизин (K); 5) Изолейцин (I), Лейцин (L), Метионин (М), Валин (V); 6) Фенилаланин (F), Тирозин (Y), Триптофан (W); 7) Серин (S), Треонин (Т) и 8) Цистеин (С), Метионин (М) (см., например, Creighton, Proteins (1984. Макромолекулярные структуры, такие как полипептидные структуры, можно описать с точки зрения различных уровней организации. Общие сведения, касающиеся такой организации, см., например,Alberts и др., Molecular Biology of the Cell, 3-е изд., 1994) и Cantor и Schimmel, Biophysical Chemistry PartI: The Conformation of Biological Macromolecuies, 1980. "Первичная структура" относится к последовательности аминокислот конкретного пептида. "Вторичная структура" относится к локально упорядоченным, трехмерным структурам, образуемым полипептидом. Эти структуры обычно называют доменами,например ферментативными доменами, внеклеточными доменами, трансмембранными доменами, доменами, формирующими поры, и цитоплазматическими хвостовыми доменами. Домены представляют собой части полипептида, которые образуют компактные единицы полипептида и обычно имеют длину от 15 до 350 аминокислот. Примеры доменов включают домены с ферментативной активностью, например домены с киназной активностью. Типичные домены образованы из секций более низкого порядка организации, таких как участки -слоев и -спиралей. "Третичная структура" относится к полной трехмерной структуре мономера полипептида. "Четвертичная структура" относится к трехмерной структуре, образованной путем нековалентной ассоциации независимых имеющих третичную структуру единиц. Анизотропные термины также известны как энергетические термины. Каждая конкретная последовательность нуклеиновых кислот также полностью охватывает "варианты сплайсинга". Аналогично, любой конкретный белок, кодируемый нуклеиновой кислотой, полностью охватывает любой белок, кодируемый вариантом сплайсинга нуклеиновой кислоты. "Варианты сплайсинга", как предполагает название, представляют собой продукты альтернативного сплайсинга гена. После транскрипции исходный транскрипт нуклеиновой кислоты может подвергнуться сплайсингу таким образом, что порождает различные (альтернативные) продукты сплайсинга нуклеиновых кислот, которые кодируют различные полипептиды. Механизмы получения вариантов сплайсинга различны, но включают альтернативный сплайсинг экзонов. Альтернативные полипептиды, происходящие от одной и- 13014900 той же нуклеиновой кислоты в результате транскрипции различных вариантов сплайсинга, также охвачены данным определением. В данное определение включены любые продукты реакции сплайсинга,включая рекомбинантные формы продуктов сплайсинга. Термин "рекомбинантный в отношении, например, к клетке, или нуклеиновой кислоте, белку, или вектору, указывает на то, что клетка, нуклеиновая кислота, белок или вектор были изменены путем введения гетерологичной нуклеиновой кислоты или белка или варианта нативной нуклеиновой кислоты или белка, или что клетка получена из измененной таким образом клетки. Таким образом, например, рекомбинантные клетки экспрессируют гены, которые не обнаруживаются в нативной (не рекомбинантной) форме указанной клетки, или экспрессируют нативные гены, либо экспрессирую гены, экспрессия которых в обычных нерекомбинантных клетках не отвечает норме, понижена или отсутствует."Строгие условия гибридизации" относятся к условиям, при которых зонд гибридизуются с целевой подпоследовательностью, но не с другими последовательностями, обычно в сложной смеси нуклеиновых кислот. Строгие условия зависят от последовательности и будут отличаться в различных случаях. Более длинные последовательности гибридизуются специфическим образом при более высоких температурах. Полное руководство по гибридизации нуклеиновых кислот можно найти в Tijssen, "Techniques in Biochemistry and Molecular Biology - Hybridization with Nucleic Probes," Overview of principles of hybridizationand the strategy of nucleic acid assays, 1993. Обычно, строгие условия выбрают таким образом, чтобы они были приблизительно на 5-10 С ниже, чем температура плавления (Tm) для конкретной последовательности при определенной ионной силе pH. Tm представляет собой температуру (при определенной ионной силе, pH, и концентрации нуклеиновых кислот), при которой 50% зондов, комплементарных целевой последовательности, равновесно гибридизуется с целевой последовательностью (поскольку целевые последовательности присутствуют в избытке, при Tm 50% зондов равновесно присоединены к сайтам связывания на целевых последовательностях). Строгие условия также могут быть достигнуты путем добавления дестабилизирующих агентов, таких как формамид. Для селективной или специфичной гибридизации за положительный сигнал принимают сигнал, по меньшей мере в два раза превышающий фоновый уровень, предпочтительно в 10 раз превышающий фоновый уровень гибридизации. Примером строгих условий гибридизации могут быть следующие условия: 50% формамид, 5 SSC (стандартный солевой раствор), и 1% ДСН, инкубирование при 42 С, или, 5 SSC, 1% ДСН, инкубирование при 65 С, с промывкой в 0,2 SSC, и 0,1% ДСН при 65 С. Нуклеиновые кислоты, которые не гибридизуются друг с другом при строгих условиях, все же считаются по существу идентичными, если полипептиды, которые они кодируют, являются по существу идентичными. Это происходит, например, когда синтезируют копию нуклеиновой кислоты, используя максимальную вырожденность кодонов, разрешенную генетическим кодом. В таких случаях, нуклеиновые кислоты обычно гибридизуют при условиях гибридизации умеренной строгости. Примеры "умеренных условий гибридизации" включают гибридизацию в буфере, состоящем из 40% формамида, 1 МNaCl, 1% ДСН при 37 С, и промывку в 1 SSC при 45 С. Положительной гибридизацией считают сигнал, уровень которого по меньшей мере в два раза превышает фоновый уровень. Для средних специалистов в данной области очевидно, что для обеспечения условий близкой степени строгости можно применять альтернативные условия гибридизации и промывки. Дополнительные рекомендации по определению параметров гибридизации приведены во многих литературных источниках, например Ausubel и др., выше. При ПЦР, для амплификации в условиях с низкой строгостью, обычно используют температуру,равную 36 С, хотя температуры отжига могут варьировать в интервале между приблизительно 32 и 48 С,в зависимости от длины праймера. Для высоко строгих условий ПЦР амплификации обычно используют температуру, приблизительно равную 62 С, хотя для высоко строгих условий температура отжига может находиться в интервале от приблизительно 50 до приблизительно 65 С, в зависимости от длины праймера и специфичности. Обычный цикл для амплификаци как с высокой, так и с низкой строгостью условий включает фазу денатурации при 90-95 С в течение 30 с-2 мин, фазу отжига, длящуюся 30 с-2 мин, и фазу элонгации при приблизительно 72 С в течение 1-2 мин. Протоколы и рекомендации по проведению реакций амплификации низкой и высокой строгости приведены, например, в Innis и др., PCR Protocols, A"Фармацевтически приемлемое вспомогательное вещество" означает вспомогательное вещество,которое можно применять для приготовления фармацевтической композиции, которое признано безопасным, нетоксичным, и желательным, и включает вспомогательные вещества, приемлемые для применения в ветеринарии, а также для фармацевтического применения для человека. Такие вспомогательные вещества могут твердыми, жидкими, полутвердыми или, в случае аэрозольных композиций, газообразными."Фармацевтически приемлемые соли и эфиры" обозначают соли и эфиры, которые фармацевтически приемлемы и имеют требуемые фармакологические свойства. Такие соли включают соли, которые могут образоваться, в случае, когда кислотные протоны, присутствующие в соединении, способны реагировать с неорганическими или органическими основаниями. Подходящие неорганические соли вклю- 14014900 чают соли, которые образованы с щелочными металлами, например натрием и калием, магнием, кальцием и алюминием. Подходящие органические соли включают соли, которые образованы с органическими основаниями, такими как аминовые основания, например этаноламин, диэтаноламин, триэтаноламин,трометамин, N метилглукамин, и тому подобные. Такие соли также включают кислотно-аддитивные соли, образованные из неорганических кислот (например, соляной и бромисто-водородной кислотами) и органических кислот (например, уксусной кислоты, лимонной кислоты, малеиновой кислоты и алкан- и аренсульфоновой кислот, такими как метансульфоновая кислота и бензолсульфоновая кислота). Фармацевтически приемлемые эфиры включают эфиры, образованные из карбокси-, сульфонилокси- и фосфоноксигрупп, присутствующих в указанных соединениях, например в C1-6 алкиловых эфирах. При наличии двух кислотных групп фармацевтически приемлемая соль или эфир могут представлять собой кислую однозамещенную солью или эфир или двузамещенную солью или эфиром; и аналогично, при наличии более двух кислотных групп, соль или эфир могут быть образованы с участием всех таких групп. Соединения, упомянутые в настоящем изобретении, могут присутствовать не в форме соли или эфира, или в форме соли и/или эфира, и при упоминании таких соединений подразумевается, что они включают как неизмененные (не превращенные в соль или эфир) соединения, так и их фармацевтически приемлемые соли и эфиры. Также, некоторые соединения, упомянутые в настоящем изобретении, могут присутствовать более чем в одной стереоизомерной форме, и при упоминании таких соединений подразумевается,что они включают все отдельные стереоизомеры и все смеси (рацемические или другие) таких стереоизомеров."Фармацевтически приемлемый", "физиологически переносимый" и другие грамматические варианты приведенных терминов, по отношению к композициям, носителям, разбавителям и реагентам, используются взаимозаменяемо и означают, что указанные вещества можно вводить человеку (применять),не вызывая нежелательных физиологических эффектов в такой степени, которая делала бы невозможным введение композиции."Терапевтически эффективное количество" означает такое количество, которое, при введении субъекту для лечения заболевания, является достаточным, чтобы влиять на лечение этого заболевания. Если не указано иначе, тармины "субъект" или "пациент" используются взаимозаменяемо и относятся к млекопитающим, таким как пациенты-люди и приматы, не являющиеся человеком, а также к экспериментальным животным, таким как кролики, крысы и мыши, и другим животным. В соответствии с этим указанный термин "субъект" или "пациент" в данной заявке означает любого пациента или субъекта, являющегося млекопитающим, которому можно вводить композиции согласно настоящему изобретению. В некоторых вариантах реализации настоящего изобретения пациент страдает патологическим состоянием, которое вызывает пониженную устойчивость к заболеванию, например ВИЧ. В одном примере реализации настоящего изобретения, чтобы определить пациентов для лечения фармацевтической композицией, включающей один или более коллектинов и/или поверхностных белков согласно указанным способам настоящего изобретения, применяют общепринятые способы скрининга для определения статуса существующего заболевания или патологического состояния у субъекта, или факторов риска, связанных с целевым или предполагаемым заболеванием или патологическим состоянием. Эти способы скрининга включают, например, офтальмологическое исследование, чтобы определить, страдает ли субъект от глазных заболеваний. Эти и другие стандартные способы позволяют практикующему врачу выбрать субъектов, нуждающихся в терапии. В некоторых вариантах реализации настоящего изобретения офтальмологические композиции для хранения, очистки, повторного увлажнения и/или дезинфецирования контактных линз, а также композиции искусственной слезы и/или контактные линзы содержат один или более коллектин и/или поверхностно-активный белок, таким образом ингибируя развитие глазных болезней у людей, которые носят контактные линзы."Сопутствующее введение" известного терапевтического препарата от рака или терапевтического препарата от воспаления с фармацевтической композицией согласно настоящему изобретению означает введение указанного препарата и композиции, которая является ингибитором тканевого фактора, например антитела или низкомолекулярного соединения, в такой момент времени, когда указанный известный препарат и указанная композиция согласно настоящему изобретению будут иметь терапевтический эффект. Такое сопутствующее введение может включать введение указанного антимикробного препарата одновременно (т.е., в одно и то же время), до или после по отношению к введению соединения согласно настоящему изобретению. Для среднего специалиста в данной области не представит сложности определить подходящее время, последовательность и дозировку введения конкретных препаратов и композиций согласно настоящему изобретению. После выбора подходящего кандидата на роль каркасного участка из того же семейства и/или того же члена семейства, вариабельные области любой из двух или обеих из тяжелой и легкой цепи получали путем прививки CDR от исходного вида в гибридные каркасные области. Сборка гибридных антител или гибридных фрагментов антител, имеющих гибридные вариабельные участки цепи, с учетом любого из вышеупомянутых аспектов, может быть выполнена с применением общепринятых способов, известных специалистам в данной области. Например, последовательности ДНК, кодирующие указанные гиб- 15014900 ридные вариабельные домены, описанные в данной заявке (т.е., каркасные области из целевого вида иCDR из исходного вида), можно получить путем олигонуклеотидного синтеза и/или ПЦР. Указанную нуклеиновую кислоту, кодирующую CDR участки, можно также выделить из антител исходного вида,используя подходящие рестрикционные фрагменты, и лигировать с каркасной областью целевого вида путем лигирования подходящими ферментами для лигирования. В качестве альтернативы, указанные каркасные области вариабельных цепей антитела исходного вида можно изменить путем сайтнаправленного мутагенеза. Поскольку гибриды конструируют из выбранных среди множества подходящих вариантов, соответствующих каждой каркасной области, существует множество комбинаций последовательностей, которые пригодны для конструирования в соответствии с принципами, описанными в данной заявке. В соответствии с этим, могут быть собраны библиотеки гибридов, имеющие элементы с различными комбинациями отдельных каркасных областей. Такие библиотеки могут представлять собой коллекции последовательностей в электронных базах данных или физические коллекции гибридов. Формирование физической библиотеки антител или фрагментов антител предпочтительно выполняют с применением синтетических олигонуклеотидов. В одном примере, олигонуклеотиды разработаны таким образом, чтобы они имели перекрывающиеся участки, так что их можно спарить и заполнить с помощью полимеразы, как в методе полимеразной цепной реакции (ПЦР). Выполняют множество этапов удлинения перекрываний, чтобы получить VL И VH генные вставки. Такие фрагменты сконструированы с участками перекрывания с константными доменами человека так, что их можно слить путем удлинения перекрываний для получения полноразмерных легких цепей и фрагментов тяжелой цепи Fd. Участки легкой и тяжелой Fd цепи можно сшить друг с другом путем удлинения перекрывающихся участков,чтобы получить отдельную вставку Fab библиотеки, чтобы потом клонировать ее в вектор для дисплея. Также можно применять альтернативные способы сборки генов гуманизированной библиотеки. Например, указанная библиотека может быть собрана из перекрывающихся олигонуклеотидов с применением подхода Лигазной Цепной Реакции (ЛЦР). Chalmers и др., Biotechniques, 30-2: 249-252, 2001. Различные формы фрагментов антител можно получить и клонировать в подходящий вектор, чтобы создать библиотеки гибридных антител или библиотеки гибридных фрагментов антител. Например, вариабельные гены можно клонировать в вектор, который содержит, в подходящей рамке считывания, оставшуюся часть необходимого константного домена. Примеры дополнительных фрагментов, которые можно клонировать, включают целые легкие цепи, Fd часть тяжелых цепей, или фрагменты, которые содержат и легкую цепь, и Fd кодирующую последовательность тяжелой цепи. В качестве альтернативы,указанные фрагменты антител, применяемые для гуманизации, могут быть одноцепочечными антителами (scFv). Любой способ отбора из системы дисплея может быть применен в отношении библиотек согласно настоящему описанию. Протоколы отбора для выделения желаемых элементов больших библиотек известны в данной области, как в примере методик фагового дисплея. Такие системы, в которых различные пептидные последовательности представлены на поверхности нитевидных бактериофагов, доказали свою пригодность для создания библиотек фрагментов антител (и последовательностей нуклеотидов, которые их кодируют) для in vitro селекции и амплификации конкретных фрагментов антител, которые связывают целевой антиген. Scott и др., Science, 249: 386, 1990. Указанные последовательности нуклеотидов, кодирующие участки VH и VL, связаны с фрагментами генов, которые кодируют лидерные сигналы, которые направляют их к периплазматическому пространству Е.coli, и, в результате, полученные фрагменты антител оказываются представленными на поверхности бактериофага, обычно как слитые с белками оболочки бактериофага (например, pIII или pVIII). В качестве альтернативы, фрагменты антител оказываются представленными снаружи на капсидах (оболочках фагов) фага лямбда или Т 7. Преимущество основанных на фагах систем дисплея состоит в том, что, так как они представляют собой биологические системы, отобранные элементы библиотеки можно амплифицировать просто путем выращивания фага, содержащего выбранный элемент библиотеки, в бактериальных клетках. Более того, поскольку последовательность нуклеотидов, которая кодирует указанный полипептидный элемент библиотеки, содержится на фаговом или фагмидном векторе, секвенирование, экспрессия и последующие генетические манипуляции относительно просты. Способы конструирования библиотек на основе бактериофагового дисплея антител и экспрессионных библиотек на основе фага лямбда хорошо известны в данной области. McCafferty и др., Nature, 348: 552, 1990; Kang и др., Proc. Natl. Acad. Sci. USA., 88:4363, 1991. Настоящее изобретение дополнительно относится к антителам и антигенраспознающим Тклеточным рецепторам (TCR), которые специфично связывают полипептиды согласно настоящему изобретению. Указанные антитела согласно настоящему изобретению включают IgG (включая IgG1, IgG2,IgG3, и IgG4), IgA (включая IgA1 и IgA2), IgD, IgE, или IgM, и IgY. При использовании в данной заявке подразумевается, что термин "антитело" (AT) включает целые антитела, включая одноцепочечные целые антитела, и их антигенсвязывающие фрагменты. Наиболее предпочтительно указанные антитела представляют собой фрагменты антител, связывающие антиген человека, согласно настоящему изобретению и включают, без ограничения, Fab, Fab' и F(ab')2, Fd, одноцепочечные Fvs (scFv), одноцепочечные антитела, связанные дисульфидными связями Fvs (sdFv), и фрагменты, включающие либо VL, либо VH домен.- 16014900 Указанные антитела могут быть любого животного происхождения, включая птиц и млекопитающих. Предпочтительно указанные антитела представляют собой антитела человека, мыши, кролика, козы,морской свинки, верблюда, лошади или цыпленка. Антигенсвязывающие молекулы или фрагменты, включая одноцепочечные антитела, могут включать вариабельную область(и) в отдельности, или в комбинации с целыми или частями следующих доменов: шарнирной области, CH1, CH2, и CH3. Также включены в настоящее изобретение любые комбинации из вариабельной области(ей) и доменов шарнирной области, CH1, CH2 и CH3. Настоящее изобретение дополнительно включает моноклональные, поликлональные, химерные, гуманизированные и моноклональные и поликлональные антитела человека, которые специфично связывают полипептиды согласно настоящему изобретению Настоящее изобретение дополнительно включает антитела, антиидиотипические по отношению к антителам согласно настоящему изобретению. Как отмечалось выше, антитела, подходящие для настоящего изобретения, могут быть моноспецифическими, биспецифическими, триспецифическими или обладать более высокой степенью мультиспецифичности. Мультиспецифические антитела могут быть специфичны в отношении различных эпитопов полипептида согласно настоящему изобретению или могут быть специфичны в отношении как полипептида согласно настоящему изобретению, так и гетерологичной композиции, такой как гетерологичный полипептид или вещество твердофазного носителя. См., например, WO 93/17715; WO 92/08802; WO 91/00360; WO 92/05793; Tutt и др., J. Immunol. 147: 60-69, 1991; патенты США с номерами 5573920; 4474893; 5601819; 4714681; 4925648, каждый из которых полностью включен в данную заявку посредством ссылки и во всех отношениях; Kostelny и др., J. Immunol. 148: 1547-1553, 1992. Антитела, подходящие для настоящего изобретения, могут быть описаны, или точно определены в контексте эпитопа(ов) или части(ей) полипептида согласно настоящему изобретению, которые опознаются или специфично связываются антителом. Указанный эпитоп(ы) или часть(и) полипептида могут быть точно определены, как описано в данной заявке, например, по их N-концевому и С-концевому положениям, по размеру, выраженному количеством следующих друг за другом остатков аминокислот. Антитела, которые специфическим образом связывают любой эпитоп или полипептид согласно настоящему изобретению, могут также быть исключены. Таким образом, настоящее изобретение включает антитела, которые специфично связывают полипептиды согласно настоящему изобретению, и допускает исключение таких антител. Антитела согласно настоящему изобретению могут также быть описаны или точно определены в контексте их перекрестной реактивности. Включены антитела, которые не связывают никакого другого аналога, ортолога или гомолога полипептидов согласно настоящему изобретению. Антитела, которые не связывают полипептиды, менее чем на 95%, менее чем на 90%, менее чем на 85%, менее чем на 80%,менее чем на 75%, менее чем на 70%, менее чем на 65%, менее чем на 60%, менее чем на 55% и менее чем на 50% идентичные (расчет методами, известными в данной области и описанными в данной заявке) полипептиду согласно настоящему изобретению, также включены в настоящее изобретение. Дополнительно включены в настоящее изобретение антитела, которые связывают только полипептиды, кодируемые полинуклеотидами, которые гибридизуются с полинуклеотидом согласно настоящему изобретению при строгих условиях гибридизации (как описано в данной заявке). Антитела согласно настоящему изобретению могут также быть описаны или точно определены в контексте их аффинности связывания. Предпочтительная аффинность связывания включает такие значения, при которых константа диссоциации, или Kd меньше 510-6 М, 10-6 М, 510-7 М, 10-7 М, 510-8 М, 10-8 М, 510-9 М, 10-9 М, 510-10 М, 1010 М, 510-11 М, 10-11 М, 510-12 М, 10-12 М, 510-13 М, 10-13 М, 510-14 М, 10-14M, 510-15 М и 10-15 М. Антитела, которые ингибируют передачу сигнала через тканевый фактор, имеют применения, которые включают, без ограничения, способы, известные в данной области для очистки, обнаружения и нацеливания на полипептиды согласно настоящему изобретению, включая методы как in vitro, так и invivo диагностики и терапии. Например, указанные антитела можно применять в иммуноанализах для качественного и количественного измерения уровней полипептидов согласно настоящему изобретению в биологических образцах. См., например, Harlow и Lane, выше, включенные в данную заявку посредством полного объема ссылок и во всех отношениях. Антитела согласно настоящему изобретению можно применять либо отдельно, либо в комбинации с другими композициями. Указанные антитела могут быть дополнительно рекомбинантным путем присоединены к гетерологичному полипептиду на N- или C-конце или химически конъюгированы (включая ковалентное и нековалентное связывание) с полипептидами или другими композициями. Например, антитела согласно настоящему изобретению можно рекомбинантным способом пришить или конъюгировать с молекулами, которые применяют в качестве меток в тестах для детекции, и эффекторными молекулами, такими как гетерологичные полипептиды, лекарственные препараты или токсины. См., например, WO 92/08495; WO 91/14438; WO 89/12624; патент США 5314995 и ЕР 0396387, каждый из которых полностью включен в данную заявку посредством ссылки и во всех отношениях. Антитела согласно настоящему изобретению можно получить любым подходящим способом, известным в данной области. Например, полипептид согласно настоящему изобретению или его антиген- 17014900 ный фрагмент можно ввести животному для индукции образования сыворотки, содержащей поликлональные антитела. Термин "моноклональное антитело" не ограничен антителами, получаемыми по гибридомной технологии. Указанный термин "моноклональное антитело" относится к антителу, которое получено из отдельного клона, включая любой эукариотический, прокариотический или фаговый клон,но не к способу, которым оно получено. Моноклональные антитела можно получить с применением множества методик, известных в данной области, включая применение гибридомной, рекомбинантной технологий и технологии фагового дисплея. Гибридомные методики включают методики, известные в данной области и описанные в Harlow иLane, выше; Hammerling и др., Monoclonal Antibodies and T-Cell Hybridomas, 563-681, 1981, указанные источники полностью включены в данную заявку посредством ссылки. Фрагменты Fab и F(ab')2 можно получить путем протеолитического расщепления, используя ферменты, такие как папаин (для получения фрагментов ) или пепсин (для получения фрагментов F(ab')2). В качестве альтернативы, антитела, которые ингибируют передачу сигнала через тканевый фактор,можно получить путем применения технологий рекомбинантной ДНК и фагового дисплея или с помощью синтетической химии, применяя методы, известные в данной области. Например, антитела согласно настоящему изобретению можно получить, применяя различные способы фагового дисплея, известные в данной области. В способах фагового дисплея функциональные домены антител выставляются на поверхности фаговой частицы, которая несет полинуклеотидные последовательности, кодирующие их. Фаги с необходимой связывающей способностью выбирали из набора или комбинаторной библиотеки антител (например, человека или мыши) путем отбора непосредственно с помощью антигена, обычно антиген связан или фиксирован на твердой поверхности или шарике. Фаги, применяемые в этих способах,обычно представляют собой нитевидные фаги, включающие fd и M13 с Fab, Fv или со стабилизированными дисульфидными связями Fv доменами антител, рекомбинантно пришитыми либо к гену III фага,либо к продукту гена VIII. Примеры способов фагового дисплея, которые можно применять для получения антител согласно настоящему изобретению, включают те, которые раскрыты в Brinkman и др., J. Immunol. Methods 182: 41-50, 1995; Ames и др., J. Immunol. Methods 184: 177-186, 1995; Kettleborough и др.,Eur. J. Immunol. 24: 952-958, 1994; Persic и др., Gene 187: 9-18, 1997; Burton и др., Advances in Immunology 57: 191-280, 1994; PCT/GB91/01134; WO 90/02809; WO 91/10737; WO 92/01047; WO 92/18619; WO 93/11236; WO 95/15982; WO 95/20401; и в патентах США с 5698426; 5223409; 5403484; 5580717; 5427908; 5750753; 5821047; 5571698; 5427908; 5516637; 5780225; 5658727 и 5733743, каждый из которых полностью включен в данную заявку посредством ссылки и во всех отношениях. Как описано в упомянутых выше источниках, после отбора фагов, из фага можно выделить участки,кодирующие антитело, и использовать их для получения целого антитела, включая антитело человека,или любого другого необходимого для связывания антигена фрагмента, и экспрессировать в любом необходимом хозяине, включая клетки млекопитающих, клетки насекомых, клетки растений, дрожжи и бактерии. Например, можно также применять методики рекомбинантного получения фрагментов Fab,Fab' и F(ab')2, с использованием методов, известных в данной области, таких как методы, раскрытые вWO 92/22324; Mullinax и др., BioTechniques 12: 864-869, 1992; и Sawai и др., AJRI34: 26-34, 1995; и Better и др., Science 240: 1041-1043, 1988. Примеры методик, которые можно применять для получения одноцепочечных Fvs и антител, включают методики, описанные в патентах США с 4946778 и 5258498, каждый из которых полностью включен в данную заявку посредством ссылки и во всех отношениях; Huston и др., Methods in Enzymology, 203: 46-88, 1991; Shu, L. и др., PNAS 90: 7995-7999, 1993; и Skerra и др., Science 240: 1038-1040,1988. Для некоторых вариантов применения, включая применение антител in vivo у людей и тесты invitro для определения антител, может оказаться предпочтительным применение химерных, гуманизированных антител или антител человека. Способы получения химерных антител известны в данной области. См., например, Morrison, Science 229: 1202, 1985; Oi и др., BioTechniques 4: 214, 1986; Gillies и др., J.Immunol. Methods, 125: 191-202, 1989 и патент США 5807715. Антитела можно гуманизировать, применяя множество методик, включающих пересадку CDR (ЕР 0239400; WO 91/09967; и патенты США с 5530101 и 5585089), замену поверхностных аминокислот (veneering) или шлифовку (ЕР 0592106; ЕР 0519596; Padlan E.A., Molecular Immunology, 28: 489-498, 1991; Studnicka и др., Protein Engineering 7: 805-814, 1994; Roguska и др., PNAS 91: 969-973, 1994), и перестановку цепей (патент США с номером 5,565,332). Антитела человека можно получить множеством способов, известных в данной области,включая способы фагового дисплея, описанные выше. См. также патенты США с номерами 4444887; 4716111; 5545806 и 5814318; и WO 98/46645; WO 98/50433; WO 98/24893; WO 98/16654; WO 96/34096;WO 96/33735 и WO 91/10741, каждый из которых полностью включен в данную заявку посредством ссылки и во всех отношениях. Дополнительно в настоящее изобретение включены антитела, рекомбинантно слитые (гибридизованные) или химически конъюгированные (включая как ковалентную, так и нековалентную конъюгацию) с полипептидом согласно настоящему изобретению. Указанные антитела могут обладать специфичностью к антигенам, отличным от полипептидов согласно настоящему изобретению. Например, ан- 18014900 титела могут применять для направленной доставки полипептидов согласно настоящему изобретению к определенным типам клеток, либо in vitro, либо in vivo, путем слияния или конъюгирования полипептидов согласно настоящему изобретению с антителами, специфичными к конкретным рецепторам клеточной поверхности. Антитела, слитые или конъюгированные с полипептидами согласно настоящему изобретению, также можно применять в in vitro иммуноанализах и методах очистки, применяя способы, известные в данной области. См., например, Harbor и др., выше, и WO 93/21232; ЕР 0439095; Naramura и др., Immunol. Lett. 39: 91-99, 1994; патент США 5474981, полностью включены в данную заявку посредством ссылки и во всех отношениях; Gillies и др., PNAS 89: 1428-1432, 1992; Fell и др., J. Immunol. 146: 2446-2452, 1991. Настоящее изобретение дополнительно включает композиции, включающие полипептиды согласно настоящему изобретению, слитые или конъюгированные с доменами антител, отличными от вариабельных областей. Например, указанные полипептиды согласно настоящему изобретению можно гибридизовать или конъюгировать с Fc-участком антитела, или его частью. Часть антитела, слитая с полипептидом согласно настоящему изобретению, может включать указанную шарнирную область, домен CH1, доменCH2 и домен CH3 или любую комбинацию целых доменов или их частей. Полипептиды согласно настоящему изобретению можно гибридизовать или конъюгировать с указанной выше частью антитела, чтобы увеличить время полужизни полипептидов in vivo, или для применения в вариантах иммуноанализа, с применением способов, известных в данной области. Указанные полипептиды также можно слить(гибридизовать) или конъюгировать с указанной выше частью антитела для образования мультимеров. Например, Fc части, слитые с полипептидами согласно настоящему изобретению, могут образовывать димеры путем образования дисульфидной связи между указанными Fc частями. Мультимерные формы более высокого порядка можно получить путем гибридизации указанных полипептидов с частями IgA иIgM. Способы слияния или конъюгирования полипептидов согласно настоящему изобретению с частями антител известны в данной области. См., например, патенты США с номерами 5336603; 5622929; 5359046; 5349053; 5447851; 5112946; ЕР 0307434, ЕР 0367166; WO 96/04388 и WO 91/06570, каждый из которых полностью включен в данную заявку посредством ссылки и во всех отношениях; Ashkenazi и др., PNAS, 88: 10535-10539, 1991; Zheng и др., J. Immunol., 154: 5590-5600, 1995; и Vil., PNAS, 89: 1133711341, 1992. Настоящее изобретение дополнительно относится к антителам, которые действуют как антагонисты передачи сигнала через тканевый фактор в настоящем изобретении. Например, настоящее изобретение включает антитела, которые нарушают взаимодействия рецептор/лиганд с уникальной конформацией полипептидов согласно настоящему изобретению, либо частично, либо полностью. Изобретение охватывает как рецептор-специфичные антитела, так и лиганд-специфичные антитела. Изобретение охватывает рецептор-специфичные антитела, которые не предотвращают связывание лиганда, но предотвращают передачу сигнала через рецептор. Передачу сигнала через рецептор можно определить с помощью методик, описанных в данной заявке, или других известных в данной области. Также изобретение охватывает рецептор-специфичные антитела, которые предотвращают как связывание лиганда, так и передачу сигнала через рецептор. Подобным образом, изобретение охватывает нейтрализующие антитела, которые связывают указанный лиганд и препятствуют связыванию лиганда с рецептором, а также антитела, которые связывают указанный лиганд, тем самым препятствуя передачи сигнала через рецептор, но не препятствуют связыванию лиганда с рецептором. Дополнительно включены антитела, которые активируют указанный рецептор. Эти антитела могут действовать как антагонисты либо всех, либо меньшего числа видов биологической активности, зависящих от опосредуемой лигандом передачи сигнала через рецептор. Указанные антитела можно точно определить как антагонисты видов биологической активности,включая специфические виды активности, раскрытые в данной заявке. Упомянутые выше антителаантагонисты можно получить, применяя методы, известные в данной области. См., например, WO 96/40281; патент США номер 5,811,097, каждый из которых полностью включен в данную заявку посредством ссылки и во всех отношениях; Deng и др., Blood 92: 1981-1988, 1998; Chen, и др., Cancer Res.,58: 3668-3678, 1998; Harrop и др., J. Immunol. 161: 1786-1794, 1998; Zhu и др., Cancer Res., 58: 3209-3214,1998; Yoon, и др., J. Immunol., 160: 3170-3179, 1998; Prat и др., J. Cell. Sci., 111: 237-247, 1998; Pitard и др.,J. Immunol. Methods, 205: 177-190, 1997; Liautard и др., Cytokinde, 9: 233-241, 1997; Carlson и др., J. Biol.Chem., 272: 11295-11301, 1997; Taryman и др., Neuron, 14: 755-762, 1995; Muller и др., Structure, 6: 11531167, 1998; Bartunek и др., Cytokinem, 8: 14-20, 1996. Как обсуждалось выше, антитела, которые ингибируют передачу сигнала через тканевый фактор на неопластических клетках или воспалительных клетках,можно, в свою очередь, применять для получения антиидиотипических антител, которые "имитируют" полипептиды согласно настоящему изобретению, с применением методик, хорошо известных специалистам в данной области. (См., например, Greenspan и др., FASEB J. 7: 437-444, 1989 и Nissinoff, J.Immunol. 147: 2429-2438, 1991). Например, антитела, которые связываются с полипептидом и конкурентно ингибируют мультимеризацию полипептидов и/или связывание полипептида согласно настоящему изобретению с лигандом, можно применять для получения антиидиотипов, которые "имитируют" мультимеризацию полипептидов и/или домен связывания и, как следствие, связывают и нейтрализуют полипептид и/или его лиганд. Такие нейтрализующие антиидиотипы или Fab фрагменты таких антиидиоти- 19014900 пов можно применять в терапевтических программах для нейтрализации лиганда полипептида. Например, такие антиидиотипические антитела можно применять для связывания полипептида согласно настоящему изобретению и/или для связывания его лигандов/рецепторов, и, тем самым, блокировать их биологическую активность."Ингибиторы", "активаторы" и "модуляторы" передачи сигнала через тканевый фактор на неопластических клетках или воспалительных клетках используют для обозначания ингибиторных, активаторных или модуляторных молекул, соответственно, определенных с применением in vitro и in vivo тестов на связывание или передачу сигнала через тканевый фактор, например лиганды, агонисты, антагонисты,и их гомологи и миметики."Модулятор" включает ингибиторы и активаторы. Ингибиторы представляют собой агенты, которые, например, связывают, частично или полностью блокируют стимуляцию, снижают, предотвращают,задерживают активацию, инактивируют, десенсибилизируют или подавляют активность передачи сигнала через тканевый фактор, например антагонисты. Активаторы представляют собой агенты, которые,например, связывают, стимулируют, повышают, открывают, активируют, способствуют, усиливают активацию, сенсибилизируют или активиуют передачу сигнала через тканевый фактор, например, агонисты. Модуляторы включают агенты, которые, например, изменяют взаимодействие сигнального тканевого фактора с белками, которые связывают активаторы или ингибиторы, с рецепторами, включая белки,пептиды, липиды, карбогидраты, полисахариды или их комбинацию, например липобелки, гликобелки, и тому подобными. Модуляторы включают генетически измененные варианты природного сигнального тканевого фактора, например, с измененной активностью, также, как природные и синтетические лиганды, антагонисты, агонисты, низкомолекулярные соединения и тому подобные. Такие тесты на определение ингибиторов включают, например, воздействие предполагаемого модуляторного соединения на клетки, экспрессирующие сигнальный тканевый фактор и затем определение функциональных эффектов на передачу сигнала через тканевый фактор, как описано в данной заявке. Образцы или тесты, включающие тканевый фактор, которые обрабатывают потенциальным активатором, ингибитором или модулятором, сравнивают с контрольными образцами без ингибитора, активатора, или модулятора для определения степени ингибирования. Контрольным образцам (необработанным ингибиторами) можно присвоить относительное значение передачи сигнала через тканевый фактор, равное 100%. Ингибирование достигается, когда значение активности передачи сигнала через тканевый фактор по отношению к контролю приблизительно равно 80%, возможно 50 или 25-0%. Способность молекулы связываться с сигнальным тканевым фактором можно определить, например, по способности предполагаемого лиганда связываться с сигнальным тканевым фактором на клетках. Специфичность связывания можно определить путем сравнения связывания с клетками, в которых есть только коагуляторный тканевый фактор. В одном варианте реализации связывание антитела с сигнальным тканевым фактором можно тестировать путем иммобилизации либо лиганда, либо рецептора. Например, указанный тест может включать иммобилизацию тканевого фактора, измененного таким образом, чтобы имитировать сигнальную конформацию, слитого с гистидиновой меткой, на Ni-активированной нитрилотриацетатной (НТА) гранулированной ионообменной смоле. Антитело можно добавить в подходящий буферный раствор с гранулами,инкубировать в течение некоторого времени при заданной температуре. После промывок для удаления несвязавшегося вещества, связанный белок можно высвободить с помощью, например, ДСН, буферных растворов с высокой pH, и тому подобных, и анализировать. Химерные белки Антитела к сигнальному тканевому фактору можно применять для получения химерных белков. Например, антитела согласно настоящему изобретению, слитые с другим белком, можно применять в качестве антигенной метки для очистки указанного антитела или для повышения стабильности антитела как терапевтического средства в качестве ингибитора передачи сигнала через тканевый фактор. Примеры доменов, которые можно гибридизовать с полипептидами, включают не только гетерологичные сигнальные последовательности, но также другие гетерологичные функциональные участки. Гибридизация не обязательно должна быть непосредственной, ее можно также осуществлять через линкерные последовательности. Для улучшения свойств полипептида можно также создать химерные белки. Например, участок из дополнительных аминокислот, замененных в конкретных положениях аминокислот, можно присоединить к N-концу полипептида, чтобы улучшить его стабильность и устойчивость во время выделения из клеток хозяина или последующего манипулирования и хранения. Также пептидные молекулы можно присоединить к указанному полипептиду для улучшения очистки. Такие участки можно удалить перед окончательным этапом получения полипептида. Добавление пептидных молекул для облегчения манипуляций с полипептидами требует применения лишь общеизвестных и стандартных методик в данной области. Более того, композиции антител и композиции, которые ингибируют передачу сигнала через тканевый фактор, включая фрагменты и, в частности, эпитопы, можно объединить с частями константного домена иммуноглобулинов (IgG), что даст химерные полипептиды. Такие химерные белки улучшают- 20014900 очистку и имеют большее время полужизни in vivo. Один из известных примеров описывает химерные белки, состоящие из первых двух доменов полипептида CD4 человека и нескольких доменов константных областей тяжелых или легких цепей иммуноглобулинов млекопитающих. ЕР А 394,827; Traunecker и др., Nature, 331: 84-86, 1988. Химерные белки, имеющие связанные дисульфидными связями димерные структуры (за счет igG), также могут быть более эффективны в связывании и нейтрализации других молекул, отличных от мономерного секретированного белка или белкового фрагмента по отдельности.Fountoulakis и др., J. Biochem. 270: 3958-3964, 1995. Аналогичным образом, ЕР-A-O 464533 (канадский аналог: 2045869) раскрывает химерные белки,включающие различные части константной области молекул иммуноглобулинов вместе с другим белком человека или его частью. Во многих случаях Fc часть в химерном белке полезна для терапии и диагностики, и, таким образом, ее наличие может приводить, например, к улучшению фармакокинетических свойств (ЕР-А 0232262). В качестве альтернативы, осуществляют удаление части Fc после экспрессии,обнаружения и очистки химерного белка. Например, часть Fc может препятствовать терапии и диагностике, если химерный белок применяют в качестве антигена для иммунизаций. При разработке лекарственных препаратов, например, белки человека, такие как IL-5 человека, гибридизовали с частями Fc для высокопроизводительного скрининга для обнаружения антагонистов IL-5 человека. Bennett и др., J. Molecular Recognition 8: 52-58, 1995; K. Johanson и др., J. Biol. Chem., 270: 9459-9471, 1995. Более того, полипептиды можно гибридизовать с маркерными последовательностями, такими как пептид, который улучшает очистку слитого полипептида. В предпочтительных вариантах реализации указанная маркерная последовательность аминокислот представляет собой гексагистидиновый пептид,такой как метка, имеющаяся в векторе pQE (QIAGEN, Inc., 9259 Eton Avenue, Чатсворс, Калифорния,91311), среди остальных, многие из которых доступны для приобретения. Как описано в Gentz и др.,Proc. Natl. Acad. Sci. USA 86: 821-824, 1989, например, гексагистидин обеспечивает удобную очистку химерного белка. Другая пептидная метка, применяемая для очистки, гемагглютининовая метка ("ГА"),соответствует эпитопу, полученному из белка гемагглютинина вируса гриппа. Wilson и др., Cell 37: 767,1984. Таким образом, с применением полинуклеотидов или полипептидов согласно настоящему изобретению можно сконструировать любые из описанных выше слитых молекул. Фаговые библиотеки на основе одноцепочечных FV (SCFV) Библиотеку антител scFv, которые ингибируют передачу сигнала через тканевый фактор у субъекта,относящегося к млекопитающим, и которые не нарушают гемостаз у субъекта, относящегося к млекопитающим, можно применять для лечения ангиогенеза, неопластического заболевания или воспалительного заболевания. Одним подходом для определения в библиотеке на основе фагового дисплея композиции антител, которая специфическим образом связывает и ингибирует сигнальный тканевый фактор, но не повышает риск кровотечения, было применение фаговых библиотек на основе scFv (см., например,Huston и др., Proc. Natl. Acad. Sci U.S.A., 85: 5879-5883, 1988; Chaudhary и др., Proc. Natl. Acad. SciU.S.A., 87: 1066-1070, 1990. Были описаны различные варианты реализаций scFv библиотек, выставленные на белках оболочки бактериофагов. Усовершенствованные варианты подходов на основе фагового дисплея также известны, например, как описано в WO 96/06213 и WO 92/01047 (Medical Research Council и др.) и WO 97/08320 (Morphosys), которые включены в данную заявку посредством ссылки. Также известен дисплей Fab библиотек, например, как описано в WO 92/01047 (CAT/MRC) и WO 91/17271 (Affymax). Можно отобрать гибридные антитела или фрагменты гибридных антител, клонированные в вектор для дисплея, которые ингибируют передачу сигнала через тканевый фактор, для лечения неопластического заболевания или воспалительного заболевания, с целью определить варианты, которые сохраняли хорошую активность связывания, так как указанное антитело или фрагмент антитела будет представлен на поверхности фаговой или фагмидной частицы. См., например, Barbas III и др., Phage Display, A Laboratory Manual, Cold Spring Harbor Laboratory Press, Колд Спринг Харбор, Нью-Йорк, 2001, содержание которого включено в данную заявку посредством ссылки. Например, в случае Fab фрагментов, продукты легкой цепи и тяжелой цепи Fd находятся под контролем Iac промотора, и каждая цепь имеет пришитый к ней лидерный сигнал, который направляет ее в периплазматическое пространство бактерии-хозяина. Там достаточно пространства для того, чтобы фрагменты антител смогли правильно собраться. Фрагменты тяжелой цепи экспрессируются сшитыми с доменом белка оболочки фага, что позволяет собранному фрагменту антитела встроиться в оболочку вновь созданной фаговой или фагмидной частицы. Получение новых фагмидных частиц требует добавления фага-помощника, который содержит все необходимые фаговые гены. Как только библиотека фрагментов антител представлена на поверхности фага или фагмиды, следует процесс, называемый пэннингом. Это метод, в котором: i) указанные антитела, представленные на поверхности фаговой или фагмидной частиц, связываются с нужным антигеном, ii) несвязавшихся смывают, iii) связавшиеся частицы элюируют с антигена, и iv) элюированные частицы встраивают в свежие бактерии-хозяева, чтобы амплифицировать обогащенный пул для дополнительного раунда селекции. Обычно выполняют три или четыре раунда пэннинга перед скринингом клонов антител на специфичность связывания. Таким путем, фаговые/фагмидные частицы позволяют связать фенотип свя- 21014900 зывания (антитело) с генотипом (ДНК), что делает успешным применение технологии дисплея антител. Тем не менее, можно применять другие виды векторов для этого процесса гуманизации, такие как клонирование библиотеки фрагментов антитела в литический фаговый вектор (системы модифицированного Т 7 или Лямбда Zap) для селекции и/или скрининга. После отбора нужных гибридных антител и/или фрагментов гибридных антител предполагается,что их можно получить в большом объеме с помощью любой методики, известной специалистам в данной области, например путем экспрессии в прокариотических или эукариотических клетках, и тому подобных. Например, гибридные антитела или фрагменты можно получить с применением традиционных методик конструирования экспрессионного вектора, который кодирует тяжелую цепь антитела, в которой CDR и, если это необходимо, минимальная часть вариабельного домена каркасной области, которые необходимы для сохранения оригинальной специфичности связывания антитела того вида, от которого оно произошло (что можно разработать согласно методикам, описанным в данной заявке), получены из антитела исходного вида, и остальная часть антитела получена из иммуноглобулина целевого вида, над которым можно проводить манипуляции, как описано в данной заявке, получая тем самым вектор для экспрессии тяжелой цепи гибридного антитела. В расширенном варианте реализации, библиотеки одноцепочечных антител Fv (scFv) можно сделать из лимфоцитов периферической крови 5, 10, 15, или 20 или более пациентов с различными раковыми заболеваниями. Полностью человеческие высокоаффинные антитела scFv затем можно отобрать,применяя синтетические сиалил-Льюис-х и Льюис-х БСА конъюгаты. В одном исследовании, эти человеческие scFv антитела были специфичны к сиалил-Льюис-х и Льюис-х, что показано методами твердофазного иммуноферментного анализа (ELISA), BIAcore и проточной цитометрии для связывания с клеточной поверхностью клеток панкреатической аденокарциномы. Секвенирование нуклеотидной последовательности выявило, что было получено по меньшей мере четыре уникальных scFv гена. Значения константы диссоциации Kd варьировались от 1,1 до 6,210-7 М, что было сравнимо с аффинностямиMAT, полученных при вторичном иммунном ответе. Эти антитела могут быть значимыми реагентами для исследования структуры и функции карбогидратных антигенов и для лечения опухолевых заболеваний человека. Мао и др., Proc. Natl. Acad. Sci. (USA 96: 6953-6958, 1999). В дополнительно расширенном варианте реализации комбинаторные библиотеки антител на основе фагового дисплея можно применять для получения и отбора широкого спектра антител к подходящему антигену, например антител, которые ингибируют передачу сигнала через тканевый фактор для лечения неопластического заболевания или воспалительного заболевания. Белки оболочки фага pVII и pIX можно применять для дисплея гетеродимерной структуры Fv участка антитела. Перспективы данной технологии были расширены до конструирования большой библиотеки одноцепочечных антител Fv (scFv) человека из 4,5109 элементов, представленных на pIX нитевидного бактериофага. Более того, многообразие, качество и полезность указанной библиотеки были показаны путем селекции клонов scFv против шести различных белковых антигенов. Стоит заметить, что более чем 90% отобранных клонов проявили положительное связывание с соответствующими антигенами после всего трех раундов пэннинга. Исследованные scFvs также имели высокую аффинность. Например, кинетический анализ (BIAcore) выявил, чтоscFvs против стафилококкового энтеротоксина В и субъединицы холерного токсина В имели наномолярные и субнаномолярные константы диссоциации, соответственно, обеспечивая аффинности, сравнимые или превосходящие таковые для MAT, полученных при иммунизации. Высокая специфичность была также достигнута, не только между очень разными белками, но также в случае более близко родственных белков, например Ricinus communis ("рицин") агглютининов (RCA60 и RCA120). Несмотря на 80% гомологию последовательностей этих двух белков. Указанные результаты позволили предположить, что производительность pIX-дисплейных библиотек потенциально может превосходить таковую для библиотекиpIII-дисплейного формата и делает их идеально подходящими для пэннинга широкого спектра целевых антигенов. Gao и др., Proc. Natl. Acad. Sci. USA 99: 12612-12616, 2001. Специфическое связывание между антителом или другим связывающим агентом и антигеном означает, что аффинность связывания равна по меньшей мере 10-6 М. Предпочтительные связывающиеся агенты связываются с аффинностями, равными по меньшей мере приблизительно 10-7 М, и предпочтительно от 10-8 до 10-9 М, 10-10 М, 10-11 М, или 10-12 М. Термин эпитоп подразумевает антигенную детерминанту, способную специфическим образом связываться с антителом. Эпитопы обычно состоят из химически активных поверхностных группировок молекул, таких как аминокислоты или боковые цепи сахаров, и обычно имеют специфичные трехмерные структурные характеристики, также, как и специфичные зарядные характеристики. Конформационные и неконформационные эпитопы отличаются тем, что связывание с первыми, но не с последними, нарушается при наличии денатурирующих растворителей. Тесты на иммунологическое связывание для определения передачи сигнала через тканевый фактор и ее модуляторов Настоящее изобретение предусматривает способы обнаружения передачи сигнала через тканевый фактор и идентификации модуляторов передачи сигнала через тканевый фактор. Как описано более подробно ниже, некоторые из указанных способов направлены на идентификацию модуляторов передачи- 22014900 сигнала через тканевый фактор в тесте, основанном на клеточной системе. Некоторые другие способы направлены на идентификацию модуляторов передачи сигнала через тканевый фактор в бесклеточной системе. В некоторых вариантах реализации тестируемые соединения подвергают скринингу для идентификации модуляторов тканевого фактора, которые ингибируют или подавляют TF/VIIa опосредуемые сигнальные активности, но не нарушают гемостаз in vivo. Такие модуляторы (например, модуляторы,представляющие собой малые молекулярные органические соединения) можно идентифицировать, используя известное соединение, которое проявляет такие желательные свойства (например, MAT 10H10) в ряде видов конкурентных тестов, описанных в данной заявке. Таким образом, некоторые способы скрининга, согласно настоящему изобретению, направлены на идентификацию соединения, которое ингибирует TF/VIIa сигналинг, но не блокирует коагуляцию. Эти способы включают измерение, в присутствии или отсутствии тестируемого соединения, связывания между (i) антителом или антигенсвязывающей молекулой, имеющей специфичность связывания, как у MAT 10H10 и (ii) полипептидом тканевого фактора, и затем определение ингибирования связывания при наличии тестируемого соединения по отношению к связыванию в отсутствие тестируемого соединения. В некоторых из этих способов используется мышиное MAT 10H10, продуцируемое гибридомой с номером доступа АТСС: НВ 9383. В некоторых из способов скрининга применяют тестируемые соединения, которые предпочтительно представляют собой малые молекулярные органические соединения, например химические соединения с молекулярным весом не более чем приблизительно 5000, и более предпочтительно не более чем приблизительно 2,500,1,000 или 500. Любые из видов методик и тестов, описанных в данной заявке, можно применять для реализации этих способов. В добавление к измерению их способности конкурировать с MAT 10H10 за связывание с тканевым фактором модуляторы, определенные таким образом, можно дополнительно проверить на активность модулирования передачи сигнала через тканевый фактор (например, активности ингибирования передачи сигнала через TF/VIIa, в то же время без значительного влияния на гемостаз). Указанные соединения можно проверить на активность ингибирования любого пути передачи сигнала, опосредуемогоTF/VIIa, как описано в данной заявке (например, фосфорилирования киназы митогенактивируемого белка (MAP киназы) или образования комплекса и передачи сигнала через активируемый протеазами рецептор 2). Тесты для измерения активностей опосредуемой TF/VIIa передачи сигнала хорошо известны в данной области. Как приведено в качестве примера в примере 8, ниже, активность TF/VIIa опосредуемой передачи сигнала можно количественного измерить с помощью теста на фосфорилирование MAP киназы, например, тестированием с помощью вестерн-блоттинга уровня фосфорилирования MAP киназы(например, ERK киназа) в эндотелиальных клетках пупочной вены человека HUVEC или клетках яичников китайских хомячков CHO, стимулированных факторами VIIa и X. Эти тесты можно применять в способах скрининга, описанных в данной заявке, для идентификации новых модуляторных соединений (например, ингибиторов) для передачи сигнала через TF. Их также можно применять в терапевтических способах согласно настоящему изобретению для наблюдения эффекта применяемого ингибитора на передачу сигнала через TF. Соединение считают ингибитором передачи сигнала через TF, если указанное соединение может ингибировать активность передачи сигнала через TF на по меньшей мере 50%, на по меньшей мере 75%, на по меньшей мере 90%, или на по меньшей мере 95% по отношению к передаче сигнала через TF в отсутствии указанного соединения. Количественное ингибирование можно измерить с помощью любого из тестов на передачу сигнала через TF, хорошо известных в данной области (см.,например, Ahamed и др., Blood 105:2384-91, 2005) или описанных в данной заявке, например снижение уровня фосфорилирования ERK в HUVEC клетках на протяжении 6 дней при условиях, описанных в примере 8, ниже. С применением любых способов тестирования, известных в данной области или описанных в данной заявке, соединения, идентифицированные способами скрининга, (или какой-либо ингибитор, применяемый в терапевтических способах согласно настоящему изобретению) можно дополнительно исследовать, чтобы удостовериться, что они не оказывают значительного влияния на опосредуемые тканевым фактором гомеостатические активности (например, коагуляцию). Например, TF опосредуемую коагуляторную активность можно измерить путем измерения количества продукции фактора Xa в HaCaT клетках с помощью вестерн-блоттинга, как показано в примерах ниже. Эти тесты можно применять для изучения тестируемых соединений, используемых в методах скрининга согласно настоящему изобретению или ингибиторных соединений, применяемых в терапевтических методах настоящего изобретения. Соединение не нарушает или не предотвращает активацию (т.е. не имеет значимого эффекта) TFопосредуемого гемостаза (например, коагуляции), если его наличие не приводит к более чем 5%, более чем 10%, более чем 15%, или более чем 25% снижению гомеостатической активности (например, коагуляторной активности, что измеряли с помощью теста на образование Xa, при условиях, описанных в данной заявке) по отношению к таковой в отсутствие указанного соединения. В некоторых вариантах реализации можно исследовать потенциальную блокирующую активность соединения на коагуляцию путем тестирования эффекта указанного соединения на связывание тканевого фактора антителом, которое, как известно, блокирует коагуляцию, опосредованную тканевым фактором. Одно такое антитело представляет собой моноклональное антитело 5G9, продуцируемое гибридомой с номером доступа- 23014900 АТСС: НВ 9382. Ингибиторные активности этого антитела на коагуляцию и подходящие тесты раскрыты очень детально в патенте США 5223427. Отсутствие значимого эффекта соединения на связываниеMAT 5G5 с тканевым фактором (например, снижения на по меньшей мере 20, 30, 40, 50, 75% или более) свидетельствует о том, что указанное соединение скорее всего не блокирует коагуляцию, опосредованную тканевым фактором. Передачу сигнала через тканевый фактор можно также детектировать и/или определить количественно, применяя любой из хорошо известных тестов на иммунологическое связывание (см., например,патенты США 4366241; 4376110; 4517288 и 4837168). Антитела, применимые для иммунологических тестов связывания, могут действовать как ингибиторы передачи сигнала через тканевый фактор, не нарушая гемостаз у субъекта, относящегося к млекопитающим. Указанные тесты на иммунологическое связывание проводят с антителами для диагностики или лечения заболевания, зависящего от измененной передачи сигнала через тканевый фактор/фактор VIIa у субъекта, относящегося к млекопитающим. Например, MAT 10H10 представляет собой антитело, которое действует как ингибитор передачи сигнала через тканевый фактор, не нарушая гемостаз у субъекта, относящегося к млекопитающим, и оно применимо в тестах на иммунологическое связывание, как вариант реализации согласно настоящему изобретению. Для обзора стандартных способов иммуноанализа, см. также Methods in Cell Biology: Antibodies inCell Biology, т. 37 (Asai, изд. 1993); Basic and Clinical Immunology (StitesTerr, ред., 7-ое изд. 1991). В тестах на иммунологическое связывание (или способах иммуноанализа) обычно применяют антитело,которое специфическим образом связывается с выбранным белком или антигеном (в этом случае, с тканевым фактором или его антигенной подпоследовательностью). Указанное антитело (например, антитело к тканевому фактору) можно получить любым из множества способов, хорошо известных специалистам в данной области, и как описано выше. В способах иммуноанализа также часто применяют агент для мечения для специфичного связывания и мечения комплекса, образованного антителом и антигеном. Указанные вещества для мечения могут сами представлять собой одни из составляющих, включенных в комплекс антитело/антиген. Таким образом, указанным веществом для мечения может быть меченый тканевый фактор. В качестве альтернативы, указанным веществом для мечения может быть другое вещество, такое как вторичное антитело,которое специфическим образом связывается с комплексами антитело/тканевый фактор (вторичное антитело обычно специфическим образом к антителу вида, от которого происходит первое антитело). Другие белки, способные специфическим образом связывать констнантные области иммуноглобулинов, такие как белок A или белок G, можно также применять в качестве вещества для мечения. Эти белки проявляют сильную неиммуногенную реактивность к констнантным областям иммуноглобулинов из множества видов (см., например, Kronval и др., J. Immunol. 111: 1401-1406, 1973; Akerstrom и др., J. Immunol. 135: 2589-2542, 1985). Указанное вещество для мечения можно модифицировать детектируемым веществом,таким как биотин, с которым могут специфическим образом связываться другие молекулы, такие как стрептавидин. Разнообразные детектируемые молекулы хорошо известны специалистам в данной области. При проведении исследований могут потребоваться этапы инкубации и/или промывок после каждой комбинации реагентов. Этапы инкубации могут длиться от приблизительно 5 с до нескольких часов,возможно от приблизительно 5 мин до приблизительно 24 ч. Тем не менее, время инкубации будет зависеть от характера анализа, антигена, объема раствора, концентраций, и тому подобного. Обычно анализ проводят при температуре внешней среды, хотя их можно вести в диапазоне температур, например от 10 до 40 С. Способы анализа неконкурентного характера Способы иммуноанализа для обнаружения передачи сигнала через тканевый фактор в образцах могут быть либо конкурентными, либо неконкурентными. Способы неконкурентного иммуноанализа представляют собой способы анализа, в которых количество антигена измеряют непосредственно. В одном предпочтительном "сэндвич"-анализе, например, антитела к тканевому фактору могут быть непосредственно связаны с твердым субстратом, на котором они иммобилизованы. Такие иммобилизованные антитела затем захватывают тканевый фактор, присутствующий в тестируемом образце. С тканевым фактором, иммобилизованными таким образом, затем связывается метящее вещество, такое как второе антитело к тканевому фактору, несущее метку. В качестве альтернативы, указанное второе антитело может не иметь метки, но может, в свою очередь, быть связано меченым третьим антителом, специфичным к антителам от видов, из которых происходит второе антитело Указанное второе или третье антитело обычно модифицировано детектируемым веществом, таким как биотин, с которым могут специфическим образом связываться другие молекулы, непример стрептавидин, для обеспечения обнаружения вещества. Способы анализа конкурентного характера В способах конкурентного анализа уровень передачи сигнала через тканевый фактор, присутствующий в образце, измеряли косвенно, путем измерения количества известного, добавленного (экзогенного) тканевого фактора, замещенного (вытесненного) из комплекса с антителом к тканевому фактору неизвестным тканевым фактором, присутствующим в образце. В одном варианте конкурентного анализа к образцу добавляли известное количество тканевого фактора и указанный образец затем приводили во- 24014900 взаимодействие с антителом, которое специфическим образом связывается с тканевым фактором. Количество экзогенного тканевого фактора, связавшегося с антителом, обратно пропорционально концентрации тканевого фактора, присутствующего в образце. В частном предпочтительном варианте реализации указанное антитело иммобилизовано на твердом субстрате. Количество тканевого фактора, связавшегося с антителом, можно определить либо путем измерения количества комплексов тканевый фактор/антитело либо, в качестве альтернативы, путем измерения количества оставшегося вне комплекса белка. Количество тканевого фактора можно обнаружить, обеспечивая меченую молекулу тканевого фактора. Анализ ингибирования гаптена представляет собой другой предпочтительный конкурентный анализ. В данном анализе известный тканевый фактор иммобилизован на твердом субстрате. Известное количество антитела к тканевому фактору добавляли к образцу и указанный образец затем приводили во взаимодействие с иммобилизованным тканевым фактором. Количество антитела к тканевому фактору,связавшегося с известным иммобилизованным тканевым фактором, обратно пропорционально количеству тканевого фактора, присутствующего в указанном образце. Снова, количество иммобилизованного антитела можно определить путем детектирования либо иммобилизованной фракции антитела, либо фракции антитела, которая остается в растворе. Детектирование может быть непосредственным, когда указанное антитело помечено, или опосредованным последующим добавлением меченого вещества, которое специфическим образом связывается с антителом, как описано выше. Определение перекрестной реактивности Варианты иммуноанализа с применением конкурентного связывания можно также применять для определения перекрестной реактивности. Например, тканевый фактор можно иммобилизовать на твердой подложке. Белки (например, тканевый фактор и гомологичные) добавляли к тест-системе, которая обеспечивает конкурирование за связывание антисыворотки с иммобилизованным антигеном. Способность добавленных белков конкурировать за связывание антисыворотки с иммобилизованным белком сравнивали со способностью тканевого фактора конкурировать самого с собой. Подсчитывали процент перекрестной реактивности вышеперечисленных белков с применением стандартных вычислений. Антисыворотки, которые проявляли перекрестную реактивность менее 10% с каждым из добавленных белков,перечисленных выше, были выбраны и объединены. Вступающие в перекрестную реакцию антитела можно удалить из объединенной антисыворотки путем иммуноабсорбции с добавленными рассмотренными белками, например гомологами с низкой степенью родства. Иммуноабсорбированные и объединенные антисыворотки затем использовали в иммуноанализе на конкурентное связывание, как описано выше, чтобы сравнить второй белок, считающийся возможным аллельным или полиморфным вариантом тканевого фактора, с иммуногенным белком. Чтобы провести это сравнение, каждый из двух белков тестировали в широком диапазоне концентраций и определяли количество каждого белка, необходимое для ингибирования 50% связывания антисыворотки с иммобилизованным белком. Если количество второго белка, необходимое для ингибирования 50% связывания,было меньше, чем в 10 раз большее, чем количество тканевого фактора, которое необходимо для ингибирования 50% связывания, тогда указанный второй белок считали специфическим образом связывающимся с поликлональными антителами, полученными к иммуногену тканевому фактору. Другие варианты тестирования Метод вестерн-блоттинга (иммуноблоттинга) применяли для обнаружения и расчета количества присутствующего в образце тканевого фактора. Данная методика обычно включает разделение белков образца по молекулярному весу путем гель-электрофореза, перенос разделенных белков на подходящую твердую подложку (такую как нитроцеллюлозный фильтр, нейлоновый фильтр или производный нейлоновый фильтр) и инкубирование образца с антителами, которые специфическим образом связывают тканевый фактор. Антитело к тканевому фактору специфическим образом связывается с тканевым фактором на твердой подложке. Эти антитела можно непосредственно пометить или, в качестве альтернативы,можно потом детектировать, примененяя меченые антитела (например, меченые антитела овцы против антител мыши), которые специфическим образом связываются с антителом к тканевому фактору. Другие варианты теста включают варианты иммуноанализа с помощью липосом (LIA), с применением липосом, созданных таким образом, чтобы они связывали специфические молекулы (например,антитела) и высвобождали инкапсулированные реагенты или маркеры. Высвобожденные вещества затем детектировали согласно стандартным методикам (см. Monroe и др., Amer. Clin. Prod. Rev. 5: 34-41, 1986). Снижение неспецифического связывания Для специалиста в данной области очевидно, что часто желательно минимизировать неспецифическое связывание в иммуноанализах. В частности, если тест включает применение антигена или антитела,иммобилизованного на твердом субстрате, желательно минимизировать уровень неспецифического связывания с субстратом. Средства снижения такого неспецифического связывания хорошо известны специалистам в данной области. Обычно эта методика включает покрытие субстрата белковым составом. В частности, белковые составы, такие как бычий сывороточный альбумин (БСА), нежирное порошковое молоко и желатин, широко используются, и порошковое молоко является наиболее предпочтительным.- 25014900 Метки Отдельные метки или детектируемые группы, применяемые в тесте, не являются критическим аспектом настоящего изобретения, так как они не имеют значимого влияния на специфическое связывание антитела, применяемого в тесте. Детектируемой группой может быть любой материал, имеющий детектируемые физические или химические свойства. Такие детектируемые метки достаточно хорошо разработаны в области иммуноанализа и, в общем, практически любую метку, применимую в таких методах,можно применять в настоящем изобретении. Таким образом, метка представляет собой любой состав,детектируемый спектроскопическими, фотохимическими, биохимическими, иммунохимическими, электрическими, оптическими или химическими средствами. Применимые в настоящем изобретении метки включают магнитные гранулы (например, DYNABEADS), флюоресцентные красители (например,флюоресцеинизотиоцианат, техасовый красный, родамин, и тому подобные), радиоактивные метки (например 3 Н, 1251, 35S, 14C или 32P), ферменты (например, пероксидаза хрена, щелочная фосфатаза и другие,обычно применяемые в твердофазном иммуноферментном анализе ELISA), хемилюминесцентные метки и колориметрические метки, такие как коллоидное золото или цветное стекло, или пластиковые гранулы(например, полистирол, полипропилен, латекс и т.д.). Указанная метка может быть связана непосредственно или опосредованно с желаемым компонентом тест-системы согласно методам, хорошо известным в данной области. Как указано выше, можно применять широкий спектр меток, и выбор метки зависит от необходимой чувствительности, легкости конъюгирования с веществом, требования по стабильности, доступной аппаратуры и средств обеспечения утилизации. Нерадиоактивные метки часто присоединяют непрямым путем. Обычно молекула лиганда (например, биотин) ковалентно связана с указанной молекулой. Лиганд затем связывается с другими молекулами (например, с молекулой стрептавидина), которые либо детектируемы по своему существу, либо ковалентно связаны с сигнальной системой, такой как детектируемый фермент, флюоресцентное соединение или хемилюминесцентное соединение. Указанные лиганды и их мишени можно применять в любой подходящей комбинации с антителами, которые узнают тканевый фактор, или вторичными антителами, которые узнают антитело к тканевому фактору. Молекулы могут также быть конъюгированы непосредственно с сигнал-образующими соединениями,например, путем конъюгирования с ферментом или флюорофором. Ферментами, интересующими в качестве меток, прежде всего будут гидролазы, в частности фосфатазы, эстеразы и гликозидазы или оксидазы, в частности пероксидазы. Флюоресцентные соединения включают флуоресцеин и его производные, родамин и его производные, данзил, умбеллиферон и т.д. Хемилюминесцентные соединения включают люциферин и 2,3 дигидрофталазиндионы, например, люминол. Для обзора различных систем мечения или получения сигнала,которые можно применять, см. патент США 4391904. Средства детекции меток хорошо известны специалистам в данной области. Таким образом, например,если метка представляет собой радиоактивную метку, средства для ее детектирования включают сцинцилляционный счетчик или фотографическую пленку как, например, в ауторадиографии. Если метка представляет собой флюоресцентную метку, ее можно обнаружить путем возбуждения флюорохрома на подходящей длине волны света и детектировать результирующую флюоресценцию. Флюоресценцию можно обнаружить визуально путем применения электронных детекторов, таких как приборы с зарядовой связью (ПЗС) или фотоумножители, и тому подобные. Подобным образом, ферментативные метки можно обнаружить путем обеспечения подходящих субстратов для фермента и детектирования результирующего продукта реакции. Наконец,простые колориметрические метки можно обнаружить путем простого наблюдения за цветом метки. Таким образом, при различных анализах тест-полосками конъюгированное золото часто проявляется розовым, тогда как различные конъюгированные с различными соединениями гранулы проявляются цветом гранулы. Некоторые варианты тестов не требуют применения меченых компонентов. Например, можно применять реакцию агглютинации для определения присутствия нужных антител. В этом случае покрытые антигеном частицы агглютинируются образцами, содержащами нужные антитела. В этом варианте ни один из компонентов не нужно метить, и присутствие нужного антитела обнаруживают путем обычного визуального наблюдения. Химическая композиция с малыми молекулами"Малая молекула" или "низкомолекулярное соединение" включает любую химическую или другую молекулу, которая может влиять на биологические процессы, при этом указанная малая молекула может действовать как ингибитор передачи сигнала через тканевый фактор без нарушения гемостаза у субъекта, относящегося к млекопитающим, применимый для лечения или диагностики заболевания у субъекта,относящегося к млекопитающим. Малые молекулы могут включать любое число терапевтических агентов, известных и используемых в настоящее время, или могут быть малыми молекулами, синтезированными в библиотеке таких молекул с целью скрининга биологической функции(й). Малые молекулы отличаются от макромолекул по размеру. Малые молекулы согласно настоящему изобретению обычно имеют молекулярный вес менее чем приблизительно 5000 дальтон (Да), предпочтительно менее чем приблизительно 2500 Да, более предпочтительно менее чем 1000 Да, наиболее предпочтительно менее чем приблизительно 500 Да. В современных способах лечения заболеваний, зависящих от передачи сиг- 26014900 нала через тканевый фактор/фактор VIIa у субъекта, относящегося к млекопитающим, указанное низкомолекулярное органическое соединение, пептидомиметик или миметики антител могут быть миметиками ингибитора антител, MAT 10H10. Малые молекулы включают без ограничения органические соединения, пептидомиметики, миметики антител и их конъюгаты. В данной заявке термин "органическое соединение" или "низкомолекулярное соединение" относится к любому основанному на углероде соединению, отличному от макромолекул,как нуклеиновые кислоты и полипептиды. В добавление к углероду, органические соединения могут содержать кальций, хлор, фтор, медь, водород, железо, калий, азот, кислород, серу и другие элементы. Органическое соединение может быть в ароматической или алифатической форме. Неограничивающие примеры органических соединений включают ацетоны, спирты, анилины, карбогидраты, моносахариды,олигосахариды, полисахариды, аминокислоты, нуклеозиды, нуклеотиды, липиды, ретиноиды, стероиды,протеогликаны, кетоны, альдегиды, насыщенные, ненасыщенные и полиненасыщенные жиры, масла и воски, алкены, сложные эфиры, эфиры, тиолы, сульфиды, циклические соединения, гетероциклические соединения, имидизолы и фенолы. Органическое соединение в данной заявке также включает нитрованные органические соединения и галогенированные (например, хлорированные) органические соединения. Способы приготовления пептидомиметиков описаны ниже. Множество малых молекул и малых молекул, идентифицированных согласно настоящему изобретению, характеризуют методиками, такими как масс-спектрометрия с использованием ускорителя (AMS; см. Turteltaub и др., Curr Pharm Des 6(10): 9911007, 2000, Bioanalytical applications of accelerator mass spectrometry for pharmaceutical research; и Enjalbal и др., Mass Spectrom Rev 19(3): 139-61, 2000, Mass spectrometry in combinatorial chemistry). Предпочтительные малые молекулы или низкомолекулярные соединения относительно легко и недорого производить, заключать в лекарственные формы или получать другими способами. Предпочтительные малые молекулы стабильны при множестве условий хранения. Предпочтительные малые молекулы можно включить в прочную ассоциацию с макромолекулами для образования молекул, которые биологически активны и имеют улучшенные фармацевтические свойства. Улучшенные фармацевтические свойства включают изменения времени циркуляции, распределения, метаболизма, модификации,выведения, секреции, элиминации и стабильности, которые благоприятны для нужной биологической активности. Улучшенные фармацевтические свойства включают изменения в токсикологических характеристиках и эффективности химической молекулы. Способы анализа с высокой пропускной способностью на выявление модуляторов передачи сигнала через тканевый фактор Как описано выше, настоящее изобретение обеспечивает способы идентификации модуляторов, например ингибиторов или активаторов, передачи сигнала через тканевый фактор, отличающиеся тем, что указанный ингибитор не нарушает гемостаз (например, у субъектов, относящихся к млекопитающим). Тестируемым соединением для применения в этих способах может быть любая малая органическая молекула или биологическое вещество, такое как белок, например антитело или пептид, сахар, низкомолекулярное соединение, нуклеиновая кислота, например антисмысловой олигонуклеотид, интерферирующая РНК, или рибозим, или липид. В качестве альтернативы модуляторами могут быть генетически измененные версии тканевого фактора. Обычно, тестируемыми соединениями будут малые органические молекулы, пептиды, антитела, липиды и аналоги липидов. По существу, любое химическое соединение можно применять в качестве потенциального модулятора или лиганда в указанных анализах согласно настоящему изобретению, хотя наиболее часто используют соединения, которые можно растворять в водных или органических (особенно основанных на ДМСО) растворах. Указанные способы анализа разработаны таким образом, чтобы можно было провести скрининг обширных библиотек химических соединений путем автоматизации этапов теста и обеспечить вещества из любого подходящего источника для анализов, которые обычно проводят параллельно (например, в микротитрационной форме на микротитрационных планшетах в роботизированных анализах). Очевидно, что существует множество поставщиков химических соединений, включая Sigma (Сент-Луис,Миссури), Aldrich (Сент-Луис, Миссури), Sigma-Aldrich (Сент-Луис, Миссури), Fluka ChemikaBiochemica Analytika (Бухс, Швейцария) и тому подобные. В одном предпочтительном варианте реализации методы скрининга с высокой пропускной способностью включают обеспечение комбинаторных библиотек малых органических молекул или пептидов,содержащих большое количесто потенциальных терапевтических соединений (потенциальных модуляторов или лигандов). Такие "комбинаторные библиотеки химических веществ" или " библиотеки лигандов" затем подвергают скринингу в одном или более анализах, как описано в данной заявке, чтобы идентифицировать те элементы в библиотеке (отдельные виды или подклассы химических веществ), которые проявляют желаемую характеристическую активность. Соединения, идентифицированные таким образом, можно применять как стандартные "соединения-прототипы" или можно применять их самих в качестве потенциальных или действительных лекарств. Комбинаторные библиотеки химических веществ представляют собой коллекции различных химических веществ, созданных либо путем химического синтеза, либо путем биологического синтеза, посредством комбинирования некоторого количества химических "строительных блоков", таких как реа- 27014900 генты. Например, линейные комбинаторные библиотеки химических веществ, такие как библиотеки полипептидов, образованы путем комбинирования набора строительных блоков химических веществ (аминокислот) любым возможным образом для данной длины соединения (т.е., числа аминокислот в полипептидном соединении). Миллионы химических веществ можно синтезировать путем такого комбинаторного смешивания химических строительных блоков. Получение и скрининг комбинаторных библиотек химических веществ хорошо известны специалистам в данной области. Такие комбинаторные библиотеки химических веществ включают, без ограничения, пептидные библиотеки (см., например, патент США 5010175, Furka, Int. J. Pept. Prot. Res. 37: 487493, 1991 и Houghton и др., Nature 354: 84-88, 1991). Можно также применять другие составляющие для получения химически разнообразных библиотек. Такие составляющие включают, без ограничения: пептоиды (например, см. публикацию РСТWO 91/19735), кодированные пептиды (например, см. публикацию РСТWO 93/20242), произвольные биоолигомеры (например, см. публикацию РСТWO 92/00091), бензодиазепины (например, патент США 5288514), разномеры, такие как гидантоин, бензодиазепины и дипептиды (Hobbs и др., Proc. Nat. Acad. Sci. USA 90: 6909-6913, 1993), винилогические полипептиды (Hagihara и др., J. Amer. Chem. Soc. 114: 6568, 1992), непептидные пептидомиметики с перемычками из глюкозных остатков (Hirschmann и др., J. Amer. Chem. Soc. 114: 9217-9218, 1992), аналоговый органический синтез библиотек малых веществ (Chen и др., J. Amer. Chem. Soc. 116: 2661, 1994),олигокарбаматы (Cho и др., Science 261: 1303, 1993), и/или пептидил фосфонаты (Campbell и др., J. Org.Chem. 59: 658, 1994), библиотеки нуклеиновых кислот (см. Ausubel, Berger и Sambrook, все см. выше),библиотеки пептидных нуклеиновых кислот (см., например, патент США 5539083), библиотеки антител(см., например, Vaughn и др., Nature Biotechnology, 14: 309-314, 1996 и PCT/US96/10287), библиотеки карбогидратов (см., например, Liang и др., Science 274: 1520-1522, 1996 и патент США 5593853), библиотеки малых органических молекул (см., например, бензодиазепины, Baum CEN, 18 янв., страница 33(1993); изопреноиды, патент США 5569588; тиазолидиноны и метатиазаноны, патент США 5549974; пирролидины, патенты США 5525735 и 5519134; морфолиновые соединения, патент США 5506337; бензодиазепины, 5288514, и тому подобные). Приборы для получения комбинаторных библиотек коммерчески доступны (см., например, 357Applied Biosystems, Фостер-Сити, Калифорния, 9050 Plus, Millipore, Бедфорд, Массачусетс). Вдобавок,различные комбинаторные библиотеки сами также коммерчески доступны (см., например, ComGenex,Принстон, Нью-Джерси, Asinex, Москва, Россия, Tripos, Inc., Сент-Луис, Миссури, ChemStar, Ltd, Москва, Россия, 3D Pharmaceuticals, Экстон, Пенсильвания, Martek Biosciences, Коламбия, Мэриленд, и т.д.). Подходящие соединения применимы как часть стратегии для идентифицикации лекарств для лечения неопластического заболевания или воспалительного заболевания, отличающихся тем, что указанное соединение ингибирует передачу сигнала через тканевый фактор и не повышает риск кровотечения. Тестируемое соединение, которое связывается с сигнальным тканевым фактором, считают подходящим соединением. Процедуры скрининга для идентификации подходящего или тестируемого соединения, которое связывается с тканевым фактором, или модулирует активность белков или полипептидов тканевого фактора,или их биологически активных частей, также включены в настоящее изобретение. Тестируемые соединения можно получить, применяя любой из ряда подходов в методах создания комбинаторных библиотек,известных в данной области, включая, но не ограничиваясь перечисленными, биологические библиотеки; пространственно адресуемые параллельные твердофазные или жидкофазные библиотеки; методы создания синтетических библиотек, требующих деконволюцию; методы создания библиотек "одна гранула одно вещество"; и методы создания синтетических библиотек с отбором путем афинной хроматографии. Подход биологических библиотек можно применять, например, для создания пептидных библиотек, тогда как другие четыре подхода применимы для создания библиотек пептидных, непептидноолигомерных или низкомолекулярных соединений (Lam, Anticancer Drug Des. 12: 145, 1997). Примеры способов синтеза молекулярных библиотек можно найти в данной области, например в: DeWitt и др.,Proc. Natl. Acad. Sci. USA. 90: 6909, 1993; Erb и др., Proc. Natl. Acad. Sci. USA 91: 11422, 1994; Zuckermann и др., J. Med. Chem. 37: 2678, 1994; Cho и др., Science 261: 1303, 1993; Carrell и др., Angew. Chem.Chem. 37: 1233, 1994. В некоторых вариантах реализации указанные тестируемые соединения представляют собой активаторные варианты тканевого фактора. Библиотеки соединений могут быть представлены в растворе (например, Houghten, Bio/Techniques 13: 412-421, 1992), или на гранулах (Lam, Nature 354: 82-84, 1991), чипах (Fodor, Nature 364: 555-556,1993), бактериях (патент США 5223409), спорах (патенты США 5571698, 5403484 и 5223409),плазмидах (Cull и др., Proc. Natl. Acad. Sci. USA 89: 1865-1869, 1992) или на фагах (Scott и др., Science 249: 386-390, 1990; Devlin, Science 249: 404-406, 1990; Cwirla и др., Proc. Natl. Acad. Sci. USA 87: 63786382, 1990; и Felici, J. Mol. Biol. 222: 301-310, 1991). Способность тестируемого вещества ингибировать активность передачи сигнала через тканевый фактор, или его биологически активной части, можно определить, например, путем исследования спо- 28014900 собности ингибировать передачу сигнала через тканевый фактор в отсутствие коагуляторной активности в присутствии тестируемого соединения. Модулирование активности тканевого фактора или его биологически активной части можно определить путем измерения передачи сигнала через тканевый фактор в отсутствие коагуляторной активности. Способность тестируемого соединения модулировать передачу сигнала через тканевый фактор, или его биологически активной части, можно также определить путем мониторинга способности тканевого фактора связываться с белком дисульфидизомеразой. Способы анализа связывания могут быть основаны на клеточной системе или бесклеточной системе. Способность соединения ингибировать передачу сигнала через тканевый фактор для лечения неопластического заболевания или воспалительного заболевания, не повышая риск кровотечения, можно определить одним из указанных способов, описанных в данной заявке или известных в данной области для определения прямого связывания. В одном варианте реализации способность соединения ингибировать передачу сигнала через тканевый фактор, не повышая риск кровотечения, можно определить путем мониторинга передачи сигнала через тканевый фактор в кератиноцитах или клетках эндотелия. Определение передачи сигнала через тканевый фактор может включать определение экспрессии рекомбинантного тканевого фактора, который также кодирует детектируемый маркер, такой как последовательностьFLAG или люциферазу. Этот тест может быть дополнительным к тесту на непосредственное связывание. Как правило, такие тесты применяют для определения способности тестируемого соединения ингибировать передачу сигнала через тканевый фактор. Как правило, способность тестируемого вещества связываться с тканевым фактором, препятствовать передаче сигнала через тканевый фактор сравнивают с контролем, в котором связывание определяют в отсутствие тестируемого соединения. В некоторых случаях используют заранее определенное эталонное значение. Такие эталонные значения можно определить по отношению к контрольным, в этом случае значение для тестируемого образца, которое отличается от эталона, будет указывать на то, что указанное соединение связывается с интересующей молекулой (например, тканевым фактором) или модулирует зависимую от тканевого фактора передачу сигнала через PAR2 в присутствии белка дисульфидизомеразы. Эталонное значение может также отражать уровень связывания, наблюдаемый для стандарта (например, аффинность антитела к сигнальному тканевому фактору). В этом случае, значение для тестируемого соединения, сходное (например, эквивалентное или меньшее) с эталоном, укажет на то, что соединение является подходящим соединением (например, связывается с сигнальным тканевым фактором в той же или большей степени, чем эталонное антитело). Настоящее изобретение дополнительно относится к новым агентам, определенным путем описанных выше способов анализа посредством скрининга, и их применениям для лечения, как описано в данной заявке. В одном варианте реализации настоящее изобретение обеспечивает варианты анализа в растворе с применением тканевого фактора, или клетки или ткани, экспрессирующей тканевый фактор, либо природные, либо рекомбинантные. В другом варианте реализации настоящее изобретение обеспечивает варианты твердофазных анализов in vitro с высокой пропускной способностью, при которых тканевый фактор, тканевый фактор в измененной подходящим образом конформации для иммитации сигнального пула клетки, или его лиганд присоединены к твердофазному субстрату посредством ковалентных или нековалентных взаимодействий. Любые из перечисленных вариантов анализа, описанные в данной заявке,можно адаптировать для скрининга с высокой пропускной способностью. В способах анализа с высокой пропускной способностью согласно настоящему изобретению, либо в растворе, либо в твердом состоянии, можно подвергнуть скринингу до нескольких тысяч различных модуляторов или лигандов за один день. Эту методологию можно применять для белка тканевого фактораin vitro, или для анализов, основанных на клеточной системе или мембранной системе, включающих продукт гена тканевого фактора или белок тканевого фактора. В частности, каждую лунку микротитрационного планшета можно использовать для проведения отдельного теста с выбранным потенциальным модулятором, или, если нужно наблюдать концентрацию или эффекты от времени инкубации, в каждых 5-10 лунках можно тестировать один и тот же модулятор. Таким образом, на одном стандартном микротитрационном планшете можно тестировать приблизительно 100 (например, 96) модуляторов. При применении 1536-луночных планшетов на одном планшете можно легко тестировать от приблизительно 100 до приблизительно 1500 различных соединений. Возможно проводить тесты с большим количеством планшетов в день; возможен тестовый скрининг приблизительно до 6000, 20000, 50000 или более чем 100000 различных соединений, с применением комплексных систем согласно настоящему изобретению. Для реакции в твердом состоянии интересующий белок или его фрагмент, например внеклеточный домен, или клетку или мембрану, включающие интересующий белок или его фрагмент как часть химерного белка, можно связать с компонентом, находящимся в твердом состоянии, непосредственно или опосредованно, через ковалентное или нековалентное связывание, например, через метку. Указанной меткой может быть любой из множества компонентов. Обычно, молекулу, связывающую метку, фиксируют на твердой подложке, и меченую интересующую молекулу присоединяют к твердой подложке посредством взаимодействия метки и молекулы, связывающей метку. Можно применять ряд меток и молекул, связывающих метку, основанных на известных молекуляр- 29

МПК / Метки

МПК: G01N 33/53, C12P 21/08, A61K 39/395

Метки: способы, специфичности, фактором, сигналов, опосредуемой, композиции, контроля, передачи, тканевым

Код ссылки

<a href="http://easpatents.com/30-14900-kompozicii-i-sposoby-kontrolya-specifichnosti-peredachi-signalov-oposreduemojj-tkanevym-faktorom.html" rel="bookmark" title="База патентов Евразийского Союза">Композиции и способы контроля специфичности передачи сигналов, опосредуемой тканевым фактором</a>

Похожие патенты